Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395H7N3

Protein Details
Accession A0A395H7N3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
36-72EEGIEKKRKRGKTDRKEKVKRVQRKENYKNGKKSQGLBasic
NLS Segment(s)
PositionSequence
38-68GIEKKRKRGKTDRKEKVKRVQRKENYKNGKK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MMVYSSGVSNNPKLQISSRDLLESVNMTREEIERREEGIEKKRKRGKTDRKEKVKRVQRKENYKNGKKSQGLSLTVVTDQCAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.33
4 0.33
5 0.3
6 0.29
7 0.28
8 0.26
9 0.24
10 0.19
11 0.14
12 0.14
13 0.13
14 0.12
15 0.13
16 0.14
17 0.16
18 0.16
19 0.18
20 0.16
21 0.17
22 0.18
23 0.21
24 0.24
25 0.3
26 0.38
27 0.38
28 0.46
29 0.52
30 0.55
31 0.6
32 0.67
33 0.68
34 0.7
35 0.78
36 0.8
37 0.84
38 0.89
39 0.89
40 0.88
41 0.87
42 0.87
43 0.85
44 0.86
45 0.84
46 0.86
47 0.87
48 0.87
49 0.88
50 0.88
51 0.88
52 0.84
53 0.84
54 0.77
55 0.71
56 0.69
57 0.65
58 0.58
59 0.51
60 0.46
61 0.38
62 0.35
63 0.32