Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HB38

Protein Details
Accession A0A395HB38    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-133AADKIEKPSRQQRKQRKNRSKKFRGVAKVKGPKKNKDBasic
NLS Segment(s)
PositionSequence
100-133KIEKPSRQQRKQRKNRSKKFRGVAKVKGPKKNKD
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPVTLRTRKFIRNPLLARKQMVVDVLHPNRANVSKDELRDKLADLYKSNKDQVSVFGFRTQYGGGKSTGFALIYDSQEALKKFEPHYRLVRIGAADKIEKPSRQQRKQRKNRSKKFRGVAKVKGPKKNKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.67
4 0.72
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.32
17 0.3
18 0.29
19 0.3
20 0.32
21 0.31
22 0.23
23 0.29
24 0.27
25 0.3
26 0.36
27 0.33
28 0.33
29 0.31
30 0.3
31 0.29
32 0.28
33 0.27
34 0.24
35 0.28
36 0.3
37 0.32
38 0.33
39 0.28
40 0.25
41 0.23
42 0.25
43 0.26
44 0.23
45 0.21
46 0.22
47 0.21
48 0.2
49 0.21
50 0.18
51 0.13
52 0.12
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.09
62 0.1
63 0.1
64 0.1
65 0.09
66 0.1
67 0.12
68 0.13
69 0.13
70 0.14
71 0.17
72 0.18
73 0.24
74 0.27
75 0.29
76 0.35
77 0.37
78 0.36
79 0.35
80 0.34
81 0.3
82 0.29
83 0.26
84 0.22
85 0.19
86 0.18
87 0.23
88 0.26
89 0.25
90 0.3
91 0.38
92 0.47
93 0.55
94 0.65
95 0.7
96 0.78
97 0.88
98 0.93
99 0.94
100 0.94
101 0.95
102 0.96
103 0.95
104 0.94
105 0.92
106 0.91
107 0.9
108 0.87
109 0.86
110 0.85
111 0.85
112 0.83
113 0.83