Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395GU18

Protein Details
Accession A0A395GU18   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
95-121EIPCKDSAAREKKKRPQKSRLHQSSYGHydrophilic
NLS Segment(s)
PositionSequence
104-112REKKKRPQK
Subcellular Location(s) nucl 14.5, mito_nucl 13.333, mito 10, cyto_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MRRRWARLFMKHRMPWGDLPRRVDSRAIASRIRPKKIMMGWSSNSTLQNINFPEETMLVQGSCRMTRPAKRSMAQLREGPLVNERLIGRAANNLEIPCKDSAAREKKKRPQKSRLHQSSYGVQCLRWTRTSRSRCATEPNDGRSHSGVLRIVSRCPFPSEGSKHYLLLWPADASF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.64
4 0.65
5 0.6
6 0.62
7 0.62
8 0.61
9 0.58
10 0.51
11 0.43
12 0.42
13 0.43
14 0.42
15 0.38
16 0.4
17 0.49
18 0.54
19 0.56
20 0.49
21 0.43
22 0.47
23 0.49
24 0.51
25 0.46
26 0.45
27 0.44
28 0.46
29 0.46
30 0.41
31 0.37
32 0.3
33 0.28
34 0.21
35 0.24
36 0.21
37 0.21
38 0.19
39 0.18
40 0.17
41 0.15
42 0.15
43 0.11
44 0.1
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.13
52 0.17
53 0.24
54 0.29
55 0.35
56 0.39
57 0.4
58 0.47
59 0.52
60 0.53
61 0.49
62 0.47
63 0.41
64 0.38
65 0.37
66 0.3
67 0.23
68 0.2
69 0.16
70 0.16
71 0.13
72 0.11
73 0.12
74 0.11
75 0.09
76 0.1
77 0.11
78 0.1
79 0.11
80 0.1
81 0.11
82 0.11
83 0.13
84 0.1
85 0.1
86 0.1
87 0.11
88 0.2
89 0.29
90 0.38
91 0.45
92 0.54
93 0.63
94 0.73
95 0.82
96 0.82
97 0.82
98 0.84
99 0.87
100 0.89
101 0.9
102 0.87
103 0.79
104 0.73
105 0.71
106 0.63
107 0.57
108 0.46
109 0.36
110 0.33
111 0.34
112 0.34
113 0.31
114 0.32
115 0.35
116 0.44
117 0.51
118 0.54
119 0.57
120 0.57
121 0.54
122 0.6
123 0.56
124 0.56
125 0.56
126 0.55
127 0.53
128 0.49
129 0.49
130 0.42
131 0.4
132 0.31
133 0.28
134 0.24
135 0.21
136 0.27
137 0.25
138 0.28
139 0.28
140 0.3
141 0.28
142 0.3
143 0.31
144 0.29
145 0.37
146 0.39
147 0.42
148 0.45
149 0.45
150 0.41
151 0.4
152 0.41
153 0.33
154 0.29
155 0.26