Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395HFF2

Protein Details
Accession A0A395HFF2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
14-42SGKQPESASREKKKKNQKKSKEEREVEDTBasic
NLS Segment(s)
PositionSequence
22-34SREKKKKNQKKSK
Subcellular Location(s) nucl 20, mito_nucl 12.999, cyto_nucl 12.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MILGEWILYRVYTSGKQPESASREKKKKNQKKSKEEREVEDTKSNESKETTPAVRISIAPRHQTMQKQHQLHVRVCVLYVLVQTHRVPTTSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.29
4 0.3
5 0.37
6 0.4
7 0.47
8 0.51
9 0.53
10 0.62
11 0.68
12 0.75
13 0.79
14 0.83
15 0.85
16 0.87
17 0.88
18 0.89
19 0.92
20 0.94
21 0.94
22 0.87
23 0.8
24 0.77
25 0.69
26 0.62
27 0.56
28 0.45
29 0.37
30 0.36
31 0.31
32 0.25
33 0.23
34 0.2
35 0.17
36 0.2
37 0.17
38 0.17
39 0.17
40 0.17
41 0.16
42 0.16
43 0.17
44 0.21
45 0.24
46 0.25
47 0.25
48 0.27
49 0.31
50 0.36
51 0.41
52 0.44
53 0.49
54 0.49
55 0.52
56 0.56
57 0.58
58 0.54
59 0.52
60 0.44
61 0.36
62 0.33
63 0.29
64 0.23
65 0.19
66 0.18
67 0.15
68 0.13
69 0.17
70 0.17
71 0.21
72 0.22