Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395GI23

Protein Details
Accession A0A395GI23   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-38VETARAKSQQRQRRKKSLFKKAAEFSHydrophilic
NLS Segment(s)
PositionSequence
10-33KRHVETARAKSQQRQRRKKSLFKK
Subcellular Location(s) nucl 19, mito_nucl 13.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MSKQSPWVKKRHVETARAKSQQRQRRKKSLFKKAAEFSLECDSDVFVAVRIRKTGQIYYLDSSSLSQWINTLSNLESYYPSPIQEIMEDIIPQVEPFPEPGGTPATPKMKNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.77
4 0.76
5 0.72
6 0.7
7 0.73
8 0.73
9 0.74
10 0.75
11 0.75
12 0.79
13 0.85
14 0.87
15 0.88
16 0.9
17 0.88
18 0.83
19 0.82
20 0.74
21 0.69
22 0.62
23 0.52
24 0.44
25 0.39
26 0.33
27 0.25
28 0.22
29 0.17
30 0.14
31 0.14
32 0.11
33 0.06
34 0.08
35 0.1
36 0.1
37 0.11
38 0.12
39 0.14
40 0.16
41 0.16
42 0.16
43 0.18
44 0.2
45 0.2
46 0.2
47 0.17
48 0.15
49 0.15
50 0.12
51 0.11
52 0.09
53 0.07
54 0.07
55 0.09
56 0.09
57 0.09
58 0.1
59 0.08
60 0.1
61 0.1
62 0.11
63 0.11
64 0.1
65 0.15
66 0.14
67 0.14
68 0.13
69 0.14
70 0.13
71 0.12
72 0.13
73 0.1
74 0.11
75 0.1
76 0.1
77 0.09
78 0.09
79 0.08
80 0.07
81 0.07
82 0.06
83 0.08
84 0.1
85 0.1
86 0.1
87 0.12
88 0.16
89 0.16
90 0.19
91 0.24
92 0.3