Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NER7

Protein Details
Accession B8NER7    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-48SFTDVAGRRRMKKKKRRRKKTWPGRMEGRGBasic
NLS Segment(s)
PositionSequence
25-43GRRRMKKKKRRRKKTWPGR
Subcellular Location(s) nucl 17, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MRTQEWQDWRRERQKANTSFTDVAGRRRMKKKKRRRKKTWPGRMEGRGWDLASWEGGPRDDLRSGLPPSKQQNSEGRSLLPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.75
4 0.7
5 0.67
6 0.6
7 0.54
8 0.52
9 0.43
10 0.4
11 0.41
12 0.41
13 0.43
14 0.51
15 0.61
16 0.63
17 0.73
18 0.79
19 0.82
20 0.89
21 0.92
22 0.93
23 0.95
24 0.96
25 0.96
26 0.95
27 0.91
28 0.86
29 0.82
30 0.75
31 0.66
32 0.57
33 0.49
34 0.39
35 0.32
36 0.25
37 0.18
38 0.15
39 0.13
40 0.11
41 0.08
42 0.08
43 0.08
44 0.09
45 0.1
46 0.12
47 0.12
48 0.13
49 0.14
50 0.19
51 0.23
52 0.26
53 0.27
54 0.31
55 0.38
56 0.45
57 0.45
58 0.45
59 0.51
60 0.5
61 0.54
62 0.49