Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395GY54

Protein Details
Accession A0A395GY54   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
344-364VPSPSFVRRARRELRERGMGLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
IPR000757  GH16  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF00722  Glyco_hydro_16  
PROSITE View protein in PROSITE  
PS51762  GH16_2  
CDD cd02181  GH16_fungal_Lam16A_glucanase  
Amino Acid Sequences MRTTATLLSAVGLTAQLSTAAYTLQDDYSLSSFFDRFTFYTGTDPTAGFVDYVDETTAEANGLVNTSSSSVYMGVDHTNVASSSGRQSVRIASDTTYTHGLFILDLAHMPGGICGTWPAFWLLGSDWPNNGEIDIIEGVNQQTTNDMTLHTSDGCTINNSGFTGTLTTDNCYVDAAGQSSNAGCGITDPSTESYGTGFNANGGGVFATEWTSSAISIYFFPRGSIPSDIATGSPDPSTWGTPVASFAGSCDIDEHFTGMQIIFDTTFCGDWAGNVWSSGSCASAASTCSDYVANNPSAFTDAYWTVNSLQVYQEDSSSTTESAAAAASSAASNITISSHKGHHVPSPSFVRRARRELRERGMGLHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.08
10 0.09
11 0.09
12 0.09
13 0.09
14 0.12
15 0.13
16 0.13
17 0.12
18 0.13
19 0.13
20 0.13
21 0.14
22 0.15
23 0.14
24 0.18
25 0.19
26 0.18
27 0.22
28 0.22
29 0.24
30 0.22
31 0.22
32 0.18
33 0.18
34 0.17
35 0.12
36 0.11
37 0.11
38 0.09
39 0.1
40 0.09
41 0.08
42 0.08
43 0.09
44 0.09
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.09
61 0.09
62 0.09
63 0.09
64 0.08
65 0.09
66 0.08
67 0.1
68 0.09
69 0.09
70 0.12
71 0.18
72 0.18
73 0.18
74 0.2
75 0.22
76 0.24
77 0.25
78 0.23
79 0.18
80 0.21
81 0.21
82 0.22
83 0.21
84 0.18
85 0.16
86 0.15
87 0.14
88 0.11
89 0.1
90 0.09
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.06
105 0.07
106 0.07
107 0.07
108 0.08
109 0.08
110 0.13
111 0.16
112 0.16
113 0.15
114 0.16
115 0.17
116 0.16
117 0.15
118 0.09
119 0.06
120 0.07
121 0.08
122 0.07
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.05
129 0.06
130 0.06
131 0.07
132 0.07
133 0.07
134 0.07
135 0.08
136 0.09
137 0.09
138 0.08
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.09
147 0.08
148 0.07
149 0.07
150 0.07
151 0.07
152 0.09
153 0.09
154 0.09
155 0.1
156 0.1
157 0.1
158 0.09
159 0.09
160 0.07
161 0.07
162 0.07
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.04
170 0.03
171 0.04
172 0.05
173 0.05
174 0.06
175 0.07
176 0.08
177 0.09
178 0.09
179 0.09
180 0.08
181 0.08
182 0.09
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.05
189 0.05
190 0.04
191 0.03
192 0.03
193 0.03
194 0.04
195 0.04
196 0.04
197 0.05
198 0.05
199 0.05
200 0.06
201 0.06
202 0.06
203 0.07
204 0.08
205 0.09
206 0.09
207 0.1
208 0.1
209 0.11
210 0.13
211 0.14
212 0.14
213 0.13
214 0.14
215 0.13
216 0.13
217 0.13
218 0.11
219 0.1
220 0.09
221 0.08
222 0.09
223 0.1
224 0.11
225 0.1
226 0.11
227 0.11
228 0.11
229 0.12
230 0.11
231 0.1
232 0.08
233 0.08
234 0.11
235 0.11
236 0.1
237 0.1
238 0.1
239 0.11
240 0.11
241 0.12
242 0.08
243 0.08
244 0.09
245 0.08
246 0.08
247 0.07
248 0.07
249 0.06
250 0.06
251 0.07
252 0.07
253 0.07
254 0.07
255 0.07
256 0.07
257 0.06
258 0.09
259 0.1
260 0.1
261 0.1
262 0.1
263 0.09
264 0.1
265 0.11
266 0.09
267 0.07
268 0.06
269 0.07
270 0.08
271 0.09
272 0.1
273 0.11
274 0.11
275 0.11
276 0.12
277 0.11
278 0.14
279 0.18
280 0.19
281 0.17
282 0.18
283 0.17
284 0.19
285 0.19
286 0.15
287 0.14
288 0.13
289 0.15
290 0.15
291 0.16
292 0.15
293 0.19
294 0.19
295 0.16
296 0.16
297 0.15
298 0.18
299 0.17
300 0.16
301 0.14
302 0.15
303 0.17
304 0.17
305 0.16
306 0.13
307 0.13
308 0.12
309 0.12
310 0.1
311 0.07
312 0.06
313 0.05
314 0.06
315 0.05
316 0.05
317 0.05
318 0.05
319 0.05
320 0.05
321 0.07
322 0.08
323 0.11
324 0.14
325 0.16
326 0.19
327 0.22
328 0.25
329 0.29
330 0.36
331 0.37
332 0.4
333 0.48
334 0.5
335 0.54
336 0.57
337 0.61
338 0.6
339 0.68
340 0.7
341 0.71
342 0.76
343 0.78
344 0.81
345 0.8
346 0.74