Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395GQ43

Protein Details
Accession A0A395GQ43   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
181-200FWKRYLPKMRDKKPSRFVLTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_nucl 12.5, nucl 9, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002575  Aminoglycoside_PTrfase  
IPR011009  Kinase-like_dom_sf  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF01636  APH  
CDD cd05120  APH_ChoK_like  
Amino Acid Sequences MDLTHDEWEAHVAKKVEEYRSIIQGTDIYENCGNRVVESRTTHGQLVAVKIQPKKWFRRSEAAMMQYASEQKGILAPRVLGCYDVKPNMTVTVTDRVPGESLDKVWHTLTRLQRETIQDQLKEQVQEFRKYTQPYIGRLGKTKTYNFFDRLHNHDMGPFDSEEEFDEWCFARVKFPLQQAFWKRYLPKMRDKKPSRFVLTHGDLAARNIIVQDGRITGIVDWEYSGFFPEYMEYALATVIHDGIEDWWLPVLKKVLEPSGYLRSKFVATIKDRGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.32
4 0.34
5 0.39
6 0.38
7 0.42
8 0.43
9 0.35
10 0.31
11 0.29
12 0.27
13 0.27
14 0.23
15 0.22
16 0.25
17 0.25
18 0.24
19 0.27
20 0.25
21 0.2
22 0.25
23 0.24
24 0.28
25 0.31
26 0.35
27 0.35
28 0.37
29 0.36
30 0.32
31 0.3
32 0.26
33 0.27
34 0.26
35 0.25
36 0.28
37 0.3
38 0.34
39 0.4
40 0.46
41 0.52
42 0.57
43 0.63
44 0.64
45 0.71
46 0.71
47 0.72
48 0.71
49 0.65
50 0.57
51 0.48
52 0.42
53 0.34
54 0.3
55 0.22
56 0.15
57 0.11
58 0.09
59 0.12
60 0.13
61 0.13
62 0.13
63 0.13
64 0.14
65 0.16
66 0.16
67 0.14
68 0.14
69 0.15
70 0.18
71 0.19
72 0.18
73 0.17
74 0.18
75 0.18
76 0.18
77 0.15
78 0.15
79 0.18
80 0.17
81 0.18
82 0.17
83 0.16
84 0.16
85 0.15
86 0.14
87 0.09
88 0.1
89 0.11
90 0.11
91 0.12
92 0.12
93 0.13
94 0.13
95 0.19
96 0.24
97 0.3
98 0.32
99 0.31
100 0.35
101 0.38
102 0.38
103 0.39
104 0.37
105 0.29
106 0.29
107 0.3
108 0.28
109 0.25
110 0.23
111 0.23
112 0.22
113 0.26
114 0.27
115 0.27
116 0.29
117 0.3
118 0.31
119 0.3
120 0.3
121 0.28
122 0.34
123 0.36
124 0.32
125 0.33
126 0.34
127 0.32
128 0.32
129 0.32
130 0.3
131 0.3
132 0.33
133 0.34
134 0.35
135 0.35
136 0.36
137 0.4
138 0.39
139 0.35
140 0.32
141 0.3
142 0.28
143 0.24
144 0.21
145 0.15
146 0.12
147 0.11
148 0.11
149 0.1
150 0.1
151 0.09
152 0.07
153 0.09
154 0.08
155 0.09
156 0.1
157 0.09
158 0.11
159 0.12
160 0.16
161 0.19
162 0.25
163 0.28
164 0.28
165 0.37
166 0.4
167 0.44
168 0.43
169 0.42
170 0.39
171 0.42
172 0.5
173 0.47
174 0.52
175 0.58
176 0.64
177 0.7
178 0.76
179 0.78
180 0.78
181 0.81
182 0.78
183 0.69
184 0.64
185 0.62
186 0.58
187 0.5
188 0.42
189 0.34
190 0.27
191 0.27
192 0.24
193 0.15
194 0.11
195 0.09
196 0.09
197 0.07
198 0.08
199 0.08
200 0.07
201 0.08
202 0.08
203 0.09
204 0.08
205 0.1
206 0.1
207 0.09
208 0.09
209 0.08
210 0.09
211 0.08
212 0.1
213 0.08
214 0.08
215 0.08
216 0.09
217 0.09
218 0.1
219 0.1
220 0.08
221 0.08
222 0.08
223 0.08
224 0.07
225 0.07
226 0.06
227 0.05
228 0.05
229 0.06
230 0.06
231 0.08
232 0.08
233 0.07
234 0.09
235 0.11
236 0.11
237 0.14
238 0.18
239 0.18
240 0.21
241 0.24
242 0.27
243 0.28
244 0.3
245 0.32
246 0.38
247 0.41
248 0.39
249 0.37
250 0.33
251 0.33
252 0.34
253 0.32
254 0.32
255 0.32