Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395H337

Protein Details
Accession A0A395H337    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
52-81EDKHEKKSIISKEKKKKQRNKKENTVAAEVBasic
NLS Segment(s)
PositionSequence
54-73KHEKKSIISKEKKKKQRNKK
Subcellular Location(s) nucl 14, mito 11, cyto_nucl 10
Family & Domain DBs
Amino Acid Sequences MVHTYTARSPGHDLTSQIKSMSLPIRRLLSSCPHFLTKQPSVHLPEKLRGLEDKHEKKSIISKEKKKKQRNKKENTVAAEVGDRQYIGEEKLGHQTKKKKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.32
4 0.28
5 0.25
6 0.2
7 0.23
8 0.28
9 0.27
10 0.26
11 0.28
12 0.31
13 0.31
14 0.32
15 0.3
16 0.32
17 0.31
18 0.31
19 0.31
20 0.3
21 0.31
22 0.33
23 0.37
24 0.34
25 0.34
26 0.32
27 0.34
28 0.37
29 0.4
30 0.42
31 0.36
32 0.33
33 0.33
34 0.32
35 0.29
36 0.24
37 0.23
38 0.24
39 0.32
40 0.35
41 0.36
42 0.38
43 0.37
44 0.37
45 0.42
46 0.44
47 0.45
48 0.48
49 0.55
50 0.64
51 0.73
52 0.83
53 0.86
54 0.88
55 0.88
56 0.91
57 0.91
58 0.91
59 0.92
60 0.92
61 0.89
62 0.84
63 0.77
64 0.66
65 0.56
66 0.48
67 0.37
68 0.28
69 0.21
70 0.15
71 0.1
72 0.11
73 0.11
74 0.11
75 0.13
76 0.13
77 0.15
78 0.25
79 0.32
80 0.33
81 0.4
82 0.48