Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395I324

Protein Details
Accession A0A395I324   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-62PPTTSTPSKPSKQQQSQKPKPASKSKDAAHydrophilic
NLS Segment(s)
PositionSequence
86-105KKRAKAEKAARRARERAERD
Subcellular Location(s) mito 21, cyto_nucl 3.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000649  IF-2B-related  
IPR042529  IF_2B-like_C  
IPR037171  NagB/RpiA_transferase-like  
Gene Ontology GO:0005634  C:nucleus  
GO:1901566  P:organonitrogen compound biosynthetic process  
Pfam View protein in Pfam  
PF01008  IF-2B  
Amino Acid Sequences MTSSTPTAPSPSPAAAAAPTTTTTTTAAAAAAAPPTTSTPSKPSKQQQSQKPKPASKSKDAAAGGSGASPATADGATAQLTPAELKKRAKAEKAARRARERAERDSGAAPGPAGGASATGSASTKKDGGSAAGSTGGGGSRGLPRRGSAQNTSQNGGSGSVSGGAGGAAAGMDKSAGGAEAKNKKTDDKNVAVFGHLYGQQRRTTIAGAGKEVHPAVLALGLQMRDYVVCGSSARCVATLLVFKRVIDAYTTPMGTSLPRHLTTHLSHQITYLSTCRPLSISQGNAIRALKLAISSIDPSTPEAEAKAFLGEFIDSFIREKITVADQVIAGSAAQKIQDGDVIVTFAGSSIVKQTLLLAHKQGKKFRVSIIDSRPLFEGKSLARTLANAGLDVQYSLIHGISHAIKAASKVFLGAHAMTSNGRLYSRVGTALVAMSAKERAGGVEVPVIVCCETVKFTDRVALDSIVVNEIADADELISAEPMQQLTDLPDPAAATVSPADAKKGAKSAAAAAAAAANAAAESNTVAQNVSSPLTGWKESANLQLLNIMYDVTPAEYVDMVVTEMGSLPPSAVPIVHRMSTNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.19
4 0.17
5 0.14
6 0.14
7 0.15
8 0.15
9 0.15
10 0.15
11 0.15
12 0.15
13 0.13
14 0.12
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.08
21 0.08
22 0.1
23 0.15
24 0.16
25 0.18
26 0.25
27 0.33
28 0.39
29 0.48
30 0.56
31 0.63
32 0.71
33 0.78
34 0.81
35 0.85
36 0.9
37 0.9
38 0.91
39 0.87
40 0.86
41 0.87
42 0.85
43 0.82
44 0.78
45 0.7
46 0.69
47 0.61
48 0.53
49 0.43
50 0.36
51 0.27
52 0.2
53 0.18
54 0.09
55 0.08
56 0.07
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.07
63 0.08
64 0.08
65 0.08
66 0.06
67 0.07
68 0.09
69 0.13
70 0.18
71 0.23
72 0.27
73 0.33
74 0.42
75 0.49
76 0.54
77 0.59
78 0.64
79 0.68
80 0.75
81 0.79
82 0.78
83 0.79
84 0.78
85 0.77
86 0.76
87 0.72
88 0.69
89 0.68
90 0.61
91 0.56
92 0.52
93 0.45
94 0.36
95 0.3
96 0.22
97 0.14
98 0.13
99 0.09
100 0.08
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.08
109 0.09
110 0.11
111 0.12
112 0.11
113 0.13
114 0.13
115 0.14
116 0.15
117 0.14
118 0.13
119 0.13
120 0.12
121 0.11
122 0.11
123 0.09
124 0.06
125 0.06
126 0.07
127 0.13
128 0.19
129 0.2
130 0.21
131 0.22
132 0.28
133 0.33
134 0.37
135 0.35
136 0.39
137 0.45
138 0.48
139 0.48
140 0.42
141 0.37
142 0.33
143 0.29
144 0.2
145 0.12
146 0.09
147 0.08
148 0.08
149 0.07
150 0.06
151 0.05
152 0.04
153 0.04
154 0.03
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.03
164 0.04
165 0.05
166 0.13
167 0.22
168 0.24
169 0.27
170 0.28
171 0.33
172 0.38
173 0.45
174 0.45
175 0.43
176 0.44
177 0.45
178 0.44
179 0.4
180 0.35
181 0.27
182 0.22
183 0.2
184 0.2
185 0.19
186 0.22
187 0.24
188 0.24
189 0.24
190 0.23
191 0.19
192 0.2
193 0.21
194 0.19
195 0.19
196 0.2
197 0.19
198 0.2
199 0.19
200 0.15
201 0.1
202 0.09
203 0.07
204 0.06
205 0.06
206 0.04
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.05
213 0.06
214 0.06
215 0.05
216 0.05
217 0.06
218 0.06
219 0.08
220 0.09
221 0.09
222 0.08
223 0.08
224 0.08
225 0.1
226 0.14
227 0.14
228 0.17
229 0.17
230 0.17
231 0.19
232 0.19
233 0.17
234 0.14
235 0.13
236 0.12
237 0.13
238 0.14
239 0.12
240 0.12
241 0.12
242 0.1
243 0.11
244 0.12
245 0.14
246 0.15
247 0.16
248 0.18
249 0.21
250 0.22
251 0.29
252 0.32
253 0.29
254 0.28
255 0.27
256 0.27
257 0.23
258 0.23
259 0.17
260 0.11
261 0.12
262 0.11
263 0.11
264 0.11
265 0.11
266 0.15
267 0.16
268 0.16
269 0.18
270 0.21
271 0.21
272 0.22
273 0.22
274 0.17
275 0.14
276 0.14
277 0.1
278 0.07
279 0.07
280 0.05
281 0.06
282 0.07
283 0.07
284 0.07
285 0.07
286 0.08
287 0.09
288 0.08
289 0.08
290 0.07
291 0.07
292 0.07
293 0.07
294 0.07
295 0.05
296 0.05
297 0.05
298 0.05
299 0.04
300 0.05
301 0.05
302 0.05
303 0.06
304 0.07
305 0.07
306 0.07
307 0.07
308 0.08
309 0.09
310 0.11
311 0.1
312 0.11
313 0.1
314 0.1
315 0.1
316 0.08
317 0.06
318 0.05
319 0.05
320 0.05
321 0.05
322 0.05
323 0.05
324 0.05
325 0.06
326 0.06
327 0.06
328 0.06
329 0.06
330 0.06
331 0.05
332 0.05
333 0.04
334 0.04
335 0.04
336 0.04
337 0.05
338 0.06
339 0.06
340 0.06
341 0.07
342 0.11
343 0.13
344 0.14
345 0.16
346 0.24
347 0.29
348 0.33
349 0.38
350 0.38
351 0.4
352 0.41
353 0.4
354 0.41
355 0.4
356 0.44
357 0.45
358 0.5
359 0.46
360 0.46
361 0.43
362 0.35
363 0.3
364 0.23
365 0.2
366 0.12
367 0.17
368 0.16
369 0.16
370 0.15
371 0.16
372 0.17
373 0.17
374 0.16
375 0.11
376 0.12
377 0.11
378 0.11
379 0.11
380 0.09
381 0.05
382 0.06
383 0.06
384 0.05
385 0.04
386 0.04
387 0.07
388 0.08
389 0.08
390 0.09
391 0.08
392 0.09
393 0.1
394 0.12
395 0.11
396 0.09
397 0.1
398 0.09
399 0.1
400 0.12
401 0.11
402 0.1
403 0.09
404 0.1
405 0.1
406 0.11
407 0.11
408 0.09
409 0.09
410 0.09
411 0.11
412 0.13
413 0.14
414 0.14
415 0.13
416 0.12
417 0.13
418 0.12
419 0.11
420 0.08
421 0.07
422 0.07
423 0.08
424 0.07
425 0.07
426 0.07
427 0.06
428 0.09
429 0.09
430 0.09
431 0.11
432 0.11
433 0.11
434 0.11
435 0.12
436 0.09
437 0.09
438 0.08
439 0.06
440 0.08
441 0.1
442 0.14
443 0.14
444 0.14
445 0.2
446 0.2
447 0.21
448 0.22
449 0.21
450 0.18
451 0.18
452 0.19
453 0.14
454 0.13
455 0.11
456 0.08
457 0.08
458 0.07
459 0.06
460 0.05
461 0.04
462 0.05
463 0.05
464 0.05
465 0.05
466 0.05
467 0.06
468 0.07
469 0.07
470 0.07
471 0.07
472 0.07
473 0.11
474 0.14
475 0.14
476 0.13
477 0.14
478 0.14
479 0.13
480 0.14
481 0.1
482 0.08
483 0.08
484 0.09
485 0.11
486 0.11
487 0.13
488 0.15
489 0.17
490 0.18
491 0.22
492 0.22
493 0.21
494 0.22
495 0.23
496 0.24
497 0.23
498 0.2
499 0.16
500 0.16
501 0.14
502 0.13
503 0.09
504 0.04
505 0.04
506 0.04
507 0.04
508 0.03
509 0.04
510 0.06
511 0.07
512 0.08
513 0.08
514 0.08
515 0.1
516 0.12
517 0.12
518 0.1
519 0.1
520 0.15
521 0.19
522 0.2
523 0.19
524 0.18
525 0.2
526 0.22
527 0.28
528 0.29
529 0.25
530 0.24
531 0.27
532 0.26
533 0.24
534 0.21
535 0.15
536 0.1
537 0.11
538 0.11
539 0.08
540 0.09
541 0.08
542 0.09
543 0.08
544 0.08
545 0.08
546 0.08
547 0.07
548 0.07
549 0.07
550 0.06
551 0.06
552 0.06
553 0.07
554 0.07
555 0.07
556 0.07
557 0.08
558 0.09
559 0.09
560 0.11
561 0.16
562 0.2
563 0.22