FuNGI

A0A395I324

Protein Details

Accession

A0A395I324

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
34-62	PPTTSTPSKPSKQQQSQKPKPASKSKDAA	Hydrophilic

NLS Segment(s)

Position	Sequence
86-105	KKRAKAEKAARRARERAERD

Subcellular Location(s)

mito 21, cyto_nucl 3.5, cyto 3

Family & Domain DBs

InterPro	View protein in InterPro IPR000649 IF-2B-related IPR042529 IF_2B-like_C IPR037171 NagB/RpiA_transferase-like
Gene Ontology	GO:0005634 C:nucleus GO:1901566 P:organonitrogen compound biosynthetic process
Pfam	View protein in Pfam PF01008 IF-2B

Amino Acid Sequences

MTSSTPTAPSPSPAAAAAPTTTTTTTAAAAAAAPPTTSTPSKPSKQQQSQKPKPASKSKDAAAGGSGASPATADGATAQLTPAELKKRAKAEKAARRARERAERDSGAAPGPAGGASATGSASTKKDGGSAAGSTGGGGSRGLPRRGSAQNTSQNGGSGSVSGGAGGAAAGMDKSAGGAEAKNKKTDDKNVAVFGHLYGQQRRTTIAGAGKEVHPAVLALGLQMRDYVVCGSSARCVATLLVFKRVIDAYTTPMGTSLPRHLTTHLSHQITYLSTCRPLSISQGNAIRALKLAISSIDPSTPEAEAKAFLGEFIDSFIREKITVADQVIAGSAAQKIQDGDVIVTFAGSSIVKQTLLLAHKQGKKFRVSIIDSRPLFEGKSLARTLANAGLDVQYSLIHGISHAIKAASKVFLGAHAMTSNGRLYSRVGTALVAMSAKERAGGVEVPVIVCCETVKFTDRVALDSIVVNEIADADELISAEPMQQLTDLPDPAAATVSPADAKKGAKSAAAAAAAAANAAAESNTVAQNVSSPLTGWKESANLQLLNIMYDVTPAEYVDMVVTEMGSLPPSAVPIVHRMSTNL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.19
3	0.19
4	0.17
5	0.14
6	0.14
7	0.15
8	0.15
9	0.15
10	0.15
11	0.15
12	0.15
13	0.13
14	0.12
15	0.1
16	0.1
17	0.1
18	0.1
19	0.09
20	0.08
21	0.08
22	0.1
23	0.15
24	0.16
25	0.18
26	0.25
27	0.33
28	0.39
29	0.48
30	0.56
31	0.63
32	0.71
33	0.78
34	0.81
35	0.85
36	0.9
37	0.9
38	0.91
39	0.87
40	0.86
41	0.87
42	0.85
43	0.82
44	0.78
45	0.7
46	0.69
47	0.61
48	0.53
49	0.43
50	0.36
51	0.27
52	0.2
53	0.18
54	0.09
55	0.08
56	0.07
57	0.06
58	0.06
59	0.05
60	0.05
61	0.05
62	0.07
63	0.08
64	0.08
65	0.08
66	0.06
67	0.07
68	0.09
69	0.13
70	0.18
71	0.23
72	0.27
73	0.33
74	0.42
75	0.49
76	0.54
77	0.59
78	0.64
79	0.68
80	0.75
81	0.79
82	0.78
83	0.79
84	0.78
85	0.77
86	0.76
87	0.72
88	0.69
89	0.68
90	0.61
91	0.56
92	0.52
93	0.45
94	0.36
95	0.3
96	0.22
97	0.14
98	0.13
99	0.09
100	0.08
101	0.06
102	0.05
103	0.05
104	0.05
105	0.05
106	0.05
107	0.06
108	0.08
109	0.09
110	0.11
111	0.12
112	0.11
113	0.13
114	0.13
115	0.14
116	0.15
117	0.14
118	0.13
119	0.13
120	0.12
121	0.11
122	0.11
123	0.09
124	0.06
125	0.06
126	0.07
127	0.13
128	0.19
129	0.2
130	0.21
131	0.22
132	0.28
133	0.33
134	0.37
135	0.35
136	0.39
137	0.45
138	0.48
139	0.48
140	0.42
141	0.37
142	0.33
143	0.29
144	0.2
145	0.12
146	0.09
147	0.08
148	0.08
149	0.07
150	0.06
151	0.05
152	0.04
153	0.04
154	0.03
155	0.02
156	0.02
157	0.02
158	0.02
159	0.02
160	0.02
161	0.02
162	0.02
163	0.03
164	0.04
165	0.05
166	0.13
167	0.22
168	0.24
169	0.27
170	0.28
171	0.33
172	0.38
173	0.45
174	0.45
175	0.43
176	0.44
177	0.45
178	0.44
179	0.4
180	0.35
181	0.27
182	0.22
183	0.2
184	0.2
185	0.19
186	0.22
187	0.24
188	0.24
189	0.24
190	0.23
191	0.19
192	0.2
193	0.21
194	0.19
195	0.19
196	0.2
197	0.19
198	0.2
199	0.19
200	0.15
201	0.1
202	0.09
203	0.07
204	0.06
205	0.06
206	0.04
207	0.06
208	0.06
209	0.06
210	0.06
211	0.06
212	0.05
213	0.06
214	0.06
215	0.05
216	0.05
217	0.06
218	0.06
219	0.08
220	0.09
221	0.09
222	0.08
223	0.08
224	0.08
225	0.1
226	0.14
227	0.14
228	0.17
229	0.17
230	0.17
231	0.19
232	0.19
233	0.17
234	0.14
235	0.13
236	0.12
237	0.13
238	0.14
239	0.12
240	0.12
241	0.12
242	0.1
243	0.11
244	0.12
245	0.14
246	0.15
247	0.16
248	0.18
249	0.21
250	0.22
251	0.29
252	0.32
253	0.29
254	0.28
255	0.27
256	0.27
257	0.23
258	0.23
259	0.17
260	0.11
261	0.12
262	0.11
263	0.11
264	0.11
265	0.11
266	0.15
267	0.16
268	0.16
269	0.18
270	0.21
271	0.21
272	0.22
273	0.22
274	0.17
275	0.14
276	0.14
277	0.1
278	0.07
279	0.07
280	0.05
281	0.06
282	0.07
283	0.07
284	0.07
285	0.07
286	0.08
287	0.09
288	0.08
289	0.08
290	0.07
291	0.07
292	0.07
293	0.07
294	0.07
295	0.05
296	0.05
297	0.05
298	0.05
299	0.04
300	0.05
301	0.05
302	0.05
303	0.06
304	0.07
305	0.07
306	0.07
307	0.07
308	0.08
309	0.09
310	0.11
311	0.1
312	0.11
313	0.1
314	0.1
315	0.1
316	0.08
317	0.06
318	0.05
319	0.05
320	0.05
321	0.05
322	0.05
323	0.05
324	0.05
325	0.06
326	0.06
327	0.06
328	0.06
329	0.06
330	0.06
331	0.05
332	0.05
333	0.04
334	0.04
335	0.04
336	0.04
337	0.05
338	0.06
339	0.06
340	0.06
341	0.07
342	0.11
343	0.13
344	0.14
345	0.16
346	0.24
347	0.29
348	0.33
349	0.38
350	0.38
351	0.4
352	0.41
353	0.4
354	0.41
355	0.4
356	0.44
357	0.45
358	0.5
359	0.46
360	0.46
361	0.43
362	0.35
363	0.3
364	0.23
365	0.2
366	0.12
367	0.17
368	0.16
369	0.16
370	0.15
371	0.16
372	0.17
373	0.17
374	0.16
375	0.11
376	0.12
377	0.11
378	0.11
379	0.11
380	0.09
381	0.05
382	0.06
383	0.06
384	0.05
385	0.04
386	0.04
387	0.07
388	0.08
389	0.08
390	0.09
391	0.08
392	0.09
393	0.1
394	0.12
395	0.11
396	0.09
397	0.1
398	0.09
399	0.1
400	0.12
401	0.11
402	0.1
403	0.09
404	0.1
405	0.1
406	0.11
407	0.11
408	0.09
409	0.09
410	0.09
411	0.11
412	0.13
413	0.14
414	0.14
415	0.13
416	0.12
417	0.13
418	0.12
419	0.11
420	0.08
421	0.07
422	0.07
423	0.08
424	0.07
425	0.07
426	0.07
427	0.06
428	0.09
429	0.09
430	0.09
431	0.11
432	0.11
433	0.11
434	0.11
435	0.12
436	0.09
437	0.09
438	0.08
439	0.06
440	0.08
441	0.1
442	0.14
443	0.14
444	0.14
445	0.2
446	0.2
447	0.21
448	0.22
449	0.21
450	0.18
451	0.18
452	0.19
453	0.14
454	0.13
455	0.11
456	0.08
457	0.08
458	0.07
459	0.06
460	0.05
461	0.04
462	0.05
463	0.05
464	0.05
465	0.05
466	0.05
467	0.06
468	0.07
469	0.07
470	0.07
471	0.07
472	0.07
473	0.11
474	0.14
475	0.14
476	0.13
477	0.14
478	0.14
479	0.13
480	0.14
481	0.1
482	0.08
483	0.08
484	0.09
485	0.11
486	0.11
487	0.13
488	0.15
489	0.17
490	0.18
491	0.22
492	0.22
493	0.21
494	0.22
495	0.23
496	0.24
497	0.23
498	0.2
499	0.16
500	0.16
501	0.14
502	0.13
503	0.09
504	0.04
505	0.04
506	0.04
507	0.04
508	0.03
509	0.04
510	0.06
511	0.07
512	0.08
513	0.08
514	0.08
515	0.1
516	0.12
517	0.12
518	0.1
519	0.1
520	0.15
521	0.19
522	0.2
523	0.19
524	0.18
525	0.2
526	0.22
527	0.28
528	0.29
529	0.25
530	0.24
531	0.27
532	0.26
533	0.24
534	0.21
535	0.15
536	0.1
537	0.11
538	0.11
539	0.08
540	0.09
541	0.08
542	0.09
543	0.08
544	0.08
545	0.08
546	0.08
547	0.07
548	0.07
549	0.07
550	0.06
551	0.06
552	0.06
553	0.07
554	0.07
555	0.07
556	0.07
557	0.08
558	0.09
559	0.09
560	0.11
561	0.16
562	0.2
563	0.22

A0A395I324

3D AlphaFold-predicted Structure Viewer