Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HTB3

Protein Details
Accession A0A395HTB3   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-38NETKLPKVPNSPKKVVRQKRDRRKKSLIHKAYEYHydrophilic
NLS Segment(s)
PositionSequence
13-30PNSPKKVVRQKRDRRKKS
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MSEDNETKLPKVPNSPKKVVRQKRDRRKKSLIHKAYEYSKLCDADICLGIRLRDSGQVTTFQADPTGFWSGFSSHLERHYPRPVQKTDKDFDDLAAGESAGESAGEEDKIRPLEDKAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.69
4 0.76
5 0.84
6 0.83
7 0.83
8 0.84
9 0.87
10 0.9
11 0.93
12 0.92
13 0.91
14 0.9
15 0.89
16 0.89
17 0.89
18 0.86
19 0.8
20 0.75
21 0.7
22 0.65
23 0.64
24 0.55
25 0.47
26 0.42
27 0.37
28 0.32
29 0.28
30 0.24
31 0.18
32 0.18
33 0.15
34 0.12
35 0.12
36 0.12
37 0.11
38 0.12
39 0.09
40 0.11
41 0.12
42 0.12
43 0.12
44 0.14
45 0.14
46 0.15
47 0.14
48 0.1
49 0.1
50 0.09
51 0.08
52 0.09
53 0.11
54 0.1
55 0.1
56 0.11
57 0.11
58 0.13
59 0.15
60 0.14
61 0.13
62 0.16
63 0.2
64 0.21
65 0.26
66 0.32
67 0.36
68 0.4
69 0.46
70 0.5
71 0.54
72 0.59
73 0.61
74 0.57
75 0.54
76 0.52
77 0.45
78 0.39
79 0.33
80 0.26
81 0.2
82 0.17
83 0.13
84 0.09
85 0.09
86 0.08
87 0.05
88 0.05
89 0.03
90 0.04
91 0.06
92 0.07
93 0.08
94 0.09
95 0.13
96 0.15
97 0.16
98 0.17
99 0.18