Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HIX0

Protein Details
Accession A0A395HIX0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
29-55AWKFVGRQVQKVRNRRREKKGSGDKTEHydrophilic
NLS Segment(s)
PositionSequence
41-49RNRRREKKG
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MAGFNTIQRPASGPLSPRPRTDLQLAADAWKFVGRQVQKVRNRRREKKGSGDKTESGSVFSEAETIVTDGDQGTMKERKEEKEEKEENVEGKDGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.4
3 0.43
4 0.42
5 0.44
6 0.43
7 0.44
8 0.45
9 0.41
10 0.34
11 0.36
12 0.35
13 0.31
14 0.28
15 0.25
16 0.21
17 0.16
18 0.14
19 0.09
20 0.16
21 0.14
22 0.22
23 0.3
24 0.39
25 0.47
26 0.57
27 0.67
28 0.71
29 0.8
30 0.82
31 0.84
32 0.84
33 0.82
34 0.83
35 0.83
36 0.81
37 0.77
38 0.72
39 0.63
40 0.56
41 0.53
42 0.42
43 0.32
44 0.25
45 0.19
46 0.14
47 0.12
48 0.1
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.04
57 0.06
58 0.06
59 0.06
60 0.11
61 0.15
62 0.16
63 0.23
64 0.27
65 0.3
66 0.38
67 0.46
68 0.48
69 0.55
70 0.58
71 0.55
72 0.58
73 0.57
74 0.5
75 0.45
76 0.39