Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395I787

Protein Details
Accession A0A395I787    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
93-118QDSPAKATPKKKRVTKKMKDEAKVKAHydrophilic
NLS Segment(s)
PositionSequence
97-112AKATPKKKRVTKKMKD
Subcellular Location(s) nucl 18.5, mito_nucl 10.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MQPIAQSNRNTQSKMRWTPENMSILWETFFESHNLTIDVDKMAAIWPNPITLVADGEEKPTARAIKERLEKFRRNLKNGGITFSMGTKRASNQDSPAKATPKKKRVTKKMKDEAKVKAEEDETLHDSGDEDIAAKDGTTIVKEEDGDEAMQEPGASANDVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.57
4 0.58
5 0.61
6 0.65
7 0.58
8 0.48
9 0.43
10 0.39
11 0.32
12 0.27
13 0.22
14 0.17
15 0.14
16 0.14
17 0.12
18 0.12
19 0.12
20 0.13
21 0.14
22 0.12
23 0.12
24 0.12
25 0.11
26 0.09
27 0.08
28 0.07
29 0.07
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.08
39 0.09
40 0.07
41 0.1
42 0.1
43 0.11
44 0.12
45 0.11
46 0.11
47 0.12
48 0.13
49 0.11
50 0.15
51 0.17
52 0.24
53 0.32
54 0.36
55 0.43
56 0.5
57 0.54
58 0.56
59 0.63
60 0.62
61 0.58
62 0.57
63 0.52
64 0.53
65 0.48
66 0.46
67 0.36
68 0.3
69 0.25
70 0.23
71 0.2
72 0.12
73 0.13
74 0.11
75 0.12
76 0.16
77 0.18
78 0.18
79 0.22
80 0.28
81 0.29
82 0.33
83 0.35
84 0.35
85 0.39
86 0.47
87 0.51
88 0.53
89 0.6
90 0.64
91 0.71
92 0.77
93 0.83
94 0.84
95 0.85
96 0.86
97 0.87
98 0.85
99 0.8
100 0.77
101 0.73
102 0.66
103 0.55
104 0.48
105 0.4
106 0.34
107 0.3
108 0.26
109 0.22
110 0.19
111 0.19
112 0.15
113 0.15
114 0.14
115 0.13
116 0.08
117 0.06
118 0.06
119 0.07
120 0.07
121 0.06
122 0.06
123 0.07
124 0.08
125 0.08
126 0.09
127 0.09
128 0.11
129 0.12
130 0.12
131 0.13
132 0.14
133 0.13
134 0.12
135 0.12
136 0.11
137 0.1
138 0.09
139 0.08
140 0.08
141 0.08