Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NIW5

Protein Details
Accession B8NIW5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-47PPISHRPPNRTDRPRRDPLRBasic
NLS Segment(s)
PositionSequence
23-57TPKTPPPISHRPPNRTDRPRRDPLRASRRRAHGAR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHPLHNRLHTPLLPTPRRPSHSTPKTPPPISHRPPNRTDRPRRDPLRASRRRAHGARINESRGPVTGEGECVGGGTGGCCFGGGEGDGLSCWDVEDGDGGYEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.57
4 0.61
5 0.61
6 0.63
7 0.64
8 0.68
9 0.73
10 0.71
11 0.73
12 0.77
13 0.73
14 0.7
15 0.67
16 0.67
17 0.64
18 0.66
19 0.65
20 0.63
21 0.67
22 0.71
23 0.74
24 0.73
25 0.78
26 0.79
27 0.78
28 0.81
29 0.79
30 0.77
31 0.74
32 0.75
33 0.75
34 0.73
35 0.71
36 0.68
37 0.69
38 0.69
39 0.62
40 0.59
41 0.54
42 0.52
43 0.53
44 0.51
45 0.48
46 0.42
47 0.42
48 0.35
49 0.29
50 0.25
51 0.18
52 0.15
53 0.12
54 0.11
55 0.11
56 0.1
57 0.1
58 0.07
59 0.07
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.05
73 0.06
74 0.06
75 0.06
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.07
83 0.07