Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HQI9

Protein Details
Accession A0A395HQI9   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-68EEEQNETRKKQRRPRRKQQGSNNRVGHydrophilic
NLS Segment(s)
PositionSequence
50-60RKKQRRPRRKQ
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MEYHGGLAIEMEIGGGKKEKCGENSSVVVVIGEGKGREEEKGEEEQNETRKKQRRPRRKQQGSNNRVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.09
3 0.09
4 0.11
5 0.15
6 0.18
7 0.21
8 0.26
9 0.28
10 0.29
11 0.3
12 0.28
13 0.25
14 0.21
15 0.18
16 0.13
17 0.11
18 0.06
19 0.06
20 0.05
21 0.05
22 0.06
23 0.06
24 0.07
25 0.08
26 0.09
27 0.11
28 0.16
29 0.16
30 0.17
31 0.19
32 0.23
33 0.28
34 0.32
35 0.31
36 0.36
37 0.44
38 0.53
39 0.61
40 0.68
41 0.72
42 0.78
43 0.88
44 0.91
45 0.93
46 0.94
47 0.95
48 0.95