FuNGI

A0A395HY32

Protein Details

Accession

A0A395HY32

Localization Confidence

High

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
65-89	AKTNDDTPHKKRKHTSPHGPDPATA	Hydrophilic
189-211	DASVRTPSRRRGRRASNNTNGNA	Hydrophilic
377-402	GGGPVWKKKGQKRTTRRVRMKPVVAP	Hydrophilic
507-550	PVQAQEPEPKKPRARKVNPEAHANYRSLKIRNKNSKGRGAGRFG	Hydrophilic

NLS Segment(s)

Position	Sequence
73-84	HKKRKHTSPHGP
91-98	TPRKKTGK
382-398	WKKKGQKRTTRRVRMKP
515-553	PKKPRARKVNPEAHANYRSLKIRNKNSKGRGAGRFGRRR

Subcellular Location(s)

nucl 19.5, cyto_nucl 14, cyto 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR021110 DNA_rep_checkpnt_protein IPR040203 Sld2
Gene Ontology	GO:0005634 C:nucleus GO:0007049 P:cell cycle GO:0006270 P:DNA replication initiation
Pfam	View protein in Pfam PF11719 Drc1-Sld2
CDD	cd22289 RecQL4_SLD2_NTD

Amino Acid Sequences

MATVMVPETAGPSATLRAELKEWERAFADANGGRKAGRSDIKKDPEIAAKYKEYSRLKSLETKPAKTNDDTPHKKRKHTSPHGPDPATAITPRKKTGKGAGGGGAFETPSKNNSATRPAAQHPAEVDPYDSPSVLRRLFSPSTHLSPLKAAIGPTPQRDGKALGLFDLLSESGGSTATPSASRIAGLKDASVRTPSRRRGRRASNNTNGNALGTIAEEGEEENDIAGGEEEESPRLERTPASSGKKWMLSTLFATPTTWRYAAMMEDGSNKKGAAAVEGAPGGNAATAEPNESETPSFLRRSTSGRFDGSTITGGLSPMAARTRPQFVGKGLSALVQGLRDMEEEQMQDDLDVLREIEAEQAAMNAQVADSQAAEGGGGPVWKKKGQKRTTRRVRMKPVVAPAKQPAPELLPGSDDGDEQEDQGPGIVTSVPETQQLLAPGPVPLEQSHTADSDLDSLHTMSEPDFDSDPDYDEGPQLRKSFSEKMKEAIAAGKPPATTEQSAPSPPVQAQEPEPKKPRARKVNPEAHANYRSLKIRNKNSKGRGAGRFGRRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.17
3	0.16
4	0.18
5	0.19
6	0.24
7	0.27
8	0.33
9	0.33
10	0.33
11	0.33
12	0.31
13	0.32
14	0.28
15	0.32
16	0.25
17	0.28
18	0.27
19	0.27
20	0.26
21	0.25
22	0.26
23	0.26
24	0.32
25	0.34
26	0.39
27	0.49
28	0.56
29	0.57
30	0.58
31	0.55
32	0.55
33	0.55
34	0.53
35	0.48
36	0.45
37	0.45
38	0.46
39	0.51
40	0.48
41	0.48
42	0.5
43	0.48
44	0.49
45	0.55
46	0.58
47	0.59
48	0.61
49	0.6
50	0.6
51	0.63
52	0.63
53	0.57
54	0.59
55	0.58
56	0.62
57	0.66
58	0.68
59	0.72
60	0.73
61	0.77
62	0.78
63	0.79
64	0.79
65	0.81
66	0.84
67	0.83
68	0.88
69	0.9
70	0.82
71	0.72
72	0.64
73	0.56
74	0.47
75	0.39
76	0.35
77	0.33
78	0.35
79	0.4
80	0.42
81	0.42
82	0.45
83	0.51
84	0.53
85	0.49
86	0.48
87	0.47
88	0.42
89	0.39
90	0.35
91	0.26
92	0.17
93	0.14
94	0.13
95	0.09
96	0.1
97	0.13
98	0.14
99	0.17
100	0.21
101	0.27
102	0.3
103	0.33
104	0.37
105	0.37
106	0.43
107	0.41
108	0.39
109	0.34
110	0.33
111	0.31
112	0.26
113	0.25
114	0.17
115	0.2
116	0.18
117	0.16
118	0.13
119	0.15
120	0.2
121	0.2
122	0.2
123	0.18
124	0.24
125	0.27
126	0.27
127	0.3
128	0.29
129	0.32
130	0.36
131	0.36
132	0.3
133	0.29
134	0.29
135	0.25
136	0.22
137	0.18
138	0.15
139	0.22
140	0.24
141	0.25
142	0.29
143	0.27
144	0.27
145	0.28
146	0.29
147	0.25
148	0.26
149	0.24
150	0.19
151	0.18
152	0.17
153	0.16
154	0.14
155	0.1
156	0.06
157	0.05
158	0.05
159	0.04
160	0.05
161	0.04
162	0.04
163	0.05
164	0.05
165	0.06
166	0.07
167	0.08
168	0.08
169	0.09
170	0.09
171	0.1
172	0.12
173	0.12
174	0.13
175	0.14
176	0.15
177	0.16
178	0.19
179	0.19
180	0.24
181	0.32
182	0.4
183	0.47
184	0.55
185	0.61
186	0.67
187	0.76
188	0.8
189	0.82
190	0.83
191	0.82
192	0.81
193	0.75
194	0.67
195	0.56
196	0.45
197	0.34
198	0.24
199	0.15
200	0.07
201	0.07
202	0.05
203	0.05
204	0.04
205	0.04
206	0.04
207	0.04
208	0.04
209	0.04
210	0.04
211	0.04
212	0.04
213	0.04
214	0.03
215	0.04
216	0.05
217	0.05
218	0.06
219	0.07
220	0.07
221	0.08
222	0.08
223	0.08
224	0.08
225	0.11
226	0.17
227	0.23
228	0.28
229	0.3
230	0.33
231	0.35
232	0.37
233	0.34
234	0.3
235	0.24
236	0.2
237	0.2
238	0.2
239	0.18
240	0.16
241	0.16
242	0.15
243	0.15
244	0.16
245	0.14
246	0.12
247	0.1
248	0.11
249	0.11
250	0.11
251	0.1
252	0.08
253	0.13
254	0.14
255	0.14
256	0.14
257	0.13
258	0.12
259	0.13
260	0.13
261	0.08
262	0.09
263	0.09
264	0.09
265	0.1
266	0.09
267	0.07
268	0.07
269	0.06
270	0.04
271	0.04
272	0.03
273	0.03
274	0.04
275	0.05
276	0.05
277	0.07
278	0.07
279	0.07
280	0.07
281	0.07
282	0.09
283	0.11
284	0.12
285	0.11
286	0.13
287	0.14
288	0.18
289	0.21
290	0.25
291	0.25
292	0.25
293	0.26
294	0.25
295	0.24
296	0.21
297	0.18
298	0.13
299	0.1
300	0.09
301	0.08
302	0.07
303	0.06
304	0.05
305	0.05
306	0.06
307	0.06
308	0.07
309	0.09
310	0.14
311	0.15
312	0.18
313	0.18
314	0.19
315	0.24
316	0.23
317	0.21
318	0.17
319	0.16
320	0.14
321	0.13
322	0.12
323	0.07
324	0.07
325	0.06
326	0.06
327	0.06
328	0.06
329	0.07
330	0.08
331	0.08
332	0.09
333	0.09
334	0.08
335	0.07
336	0.07
337	0.06
338	0.05
339	0.05
340	0.05
341	0.04
342	0.05
343	0.05
344	0.06
345	0.05
346	0.05
347	0.05
348	0.05
349	0.05
350	0.05
351	0.05
352	0.04
353	0.03
354	0.04
355	0.04
356	0.05
357	0.04
358	0.04
359	0.05
360	0.04
361	0.05
362	0.04
363	0.04
364	0.04
365	0.05
366	0.06
367	0.08
368	0.11
369	0.15
370	0.23
371	0.3
372	0.41
373	0.49
374	0.6
375	0.68
376	0.77
377	0.84
378	0.88
379	0.91
380	0.9
381	0.91
382	0.89
383	0.85
384	0.79
385	0.77
386	0.75
387	0.67
388	0.6
389	0.54
390	0.51
391	0.45
392	0.4
393	0.32
394	0.26
395	0.27
396	0.25
397	0.22
398	0.17
399	0.17
400	0.18
401	0.17
402	0.13
403	0.11
404	0.13
405	0.12
406	0.12
407	0.12
408	0.11
409	0.1
410	0.11
411	0.1
412	0.07
413	0.07
414	0.07
415	0.06
416	0.08
417	0.1
418	0.1
419	0.11
420	0.12
421	0.12
422	0.13
423	0.14
424	0.14
425	0.13
426	0.13
427	0.12
428	0.12
429	0.12
430	0.12
431	0.11
432	0.15
433	0.17
434	0.19
435	0.2
436	0.2
437	0.19
438	0.18
439	0.18
440	0.15
441	0.13
442	0.11
443	0.11
444	0.1
445	0.1
446	0.1
447	0.1
448	0.08
449	0.1
450	0.11
451	0.12
452	0.13
453	0.13
454	0.15
455	0.16
456	0.18
457	0.17
458	0.16
459	0.14
460	0.17
461	0.2
462	0.2
463	0.24
464	0.23
465	0.23
466	0.24
467	0.29
468	0.36
469	0.4
470	0.46
471	0.43
472	0.45
473	0.47
474	0.46
475	0.41
476	0.38
477	0.34
478	0.28
479	0.27
480	0.27
481	0.24
482	0.24
483	0.27
484	0.25
485	0.25
486	0.24
487	0.28
488	0.3
489	0.32
490	0.33
491	0.3
492	0.28
493	0.27
494	0.27
495	0.24
496	0.23
497	0.28
498	0.36
499	0.4
500	0.47
501	0.53
502	0.59
503	0.66
504	0.73
505	0.77
506	0.78
507	0.82
508	0.84
509	0.88
510	0.9
511	0.85
512	0.85
513	0.79
514	0.76
515	0.7
516	0.61
517	0.53
518	0.49
519	0.51
520	0.48
521	0.52
522	0.54
523	0.61
524	0.7
525	0.76
526	0.8
527	0.83
528	0.86
529	0.85
530	0.84
531	0.81
532	0.79
533	0.79

A0A395HY32

3D AlphaFold-predicted Structure Viewer