Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HQL4

Protein Details
Accession A0A395HQL4   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
115-139STAAPKTTEKPRRKLRARKAAMKVTHydrophilic
NLS Segment(s)
PositionSequence
123-135EKPRRKLRARKAA
Subcellular Location(s) mito 21.5, mito_nucl 13, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000361  FeS_biogenesis  
IPR016092  FeS_cluster_insertion  
IPR017870  FeS_cluster_insertion_CS  
IPR035903  HesB-like_dom_sf  
Gene Ontology GO:0051536  F:iron-sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF01521  Fe-S_biosyn  
PROSITE View protein in PROSITE  
PS01152  HESB  
Amino Acid Sequences MQPLVTSSATLLSLLRQSSSRRTVQTYRLFSSYGNSHRSSSKRDMQTATAYRPHSLPTSFPPPRTSGSSDNSIAADFPSFREMASPQLPGQQAYSPNPGLSEGEAQKLKPTETVSTAAPKTTEKPRRKLRARKAAMKVTPVAIEQLRKLLSQPEPKMIRVGVKNRGCSGLAYHLEYVEKPGTFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEECGCGESFMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.19
5 0.27
6 0.33
7 0.37
8 0.37
9 0.44
10 0.49
11 0.56
12 0.62
13 0.6
14 0.57
15 0.54
16 0.5
17 0.43
18 0.42
19 0.4
20 0.37
21 0.35
22 0.33
23 0.34
24 0.39
25 0.43
26 0.45
27 0.46
28 0.49
29 0.5
30 0.54
31 0.55
32 0.51
33 0.57
34 0.54
35 0.51
36 0.47
37 0.42
38 0.39
39 0.36
40 0.35
41 0.29
42 0.25
43 0.23
44 0.23
45 0.32
46 0.34
47 0.35
48 0.36
49 0.36
50 0.38
51 0.4
52 0.39
53 0.34
54 0.35
55 0.38
56 0.36
57 0.34
58 0.31
59 0.26
60 0.21
61 0.16
62 0.13
63 0.08
64 0.08
65 0.09
66 0.08
67 0.08
68 0.09
69 0.1
70 0.13
71 0.15
72 0.16
73 0.14
74 0.19
75 0.2
76 0.19
77 0.19
78 0.18
79 0.19
80 0.2
81 0.24
82 0.19
83 0.19
84 0.18
85 0.18
86 0.15
87 0.13
88 0.15
89 0.11
90 0.15
91 0.15
92 0.15
93 0.17
94 0.17
95 0.16
96 0.14
97 0.15
98 0.13
99 0.15
100 0.17
101 0.15
102 0.18
103 0.18
104 0.16
105 0.15
106 0.15
107 0.16
108 0.24
109 0.33
110 0.35
111 0.44
112 0.54
113 0.64
114 0.73
115 0.8
116 0.81
117 0.82
118 0.83
119 0.83
120 0.81
121 0.78
122 0.7
123 0.63
124 0.53
125 0.43
126 0.37
127 0.27
128 0.22
129 0.15
130 0.14
131 0.12
132 0.14
133 0.14
134 0.13
135 0.13
136 0.16
137 0.21
138 0.29
139 0.3
140 0.36
141 0.37
142 0.38
143 0.39
144 0.35
145 0.34
146 0.32
147 0.36
148 0.37
149 0.39
150 0.41
151 0.41
152 0.42
153 0.37
154 0.31
155 0.28
156 0.26
157 0.23
158 0.23
159 0.22
160 0.21
161 0.21
162 0.2
163 0.21
164 0.16
165 0.14
166 0.12
167 0.13
168 0.15
169 0.14
170 0.14
171 0.13
172 0.11
173 0.12
174 0.12
175 0.12
176 0.09
177 0.1
178 0.1
179 0.07
180 0.06
181 0.06
182 0.07
183 0.08
184 0.09
185 0.09
186 0.1
187 0.1
188 0.1
189 0.08
190 0.1
191 0.1
192 0.11
193 0.1
194 0.11
195 0.11
196 0.14
197 0.14
198 0.12
199 0.13
200 0.18
201 0.21
202 0.24
203 0.32
204 0.31
205 0.37
206 0.41
207 0.46
208 0.53
209 0.58
210 0.64
211 0.61
212 0.68
213 0.65
214 0.65
215 0.58
216 0.51
217 0.46
218 0.39
219 0.35