Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8N217

Protein Details
Accession B8N217    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-24IEKLQAKQRYARRKHRSTFSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MGLIEKLQAKQRYARRKHRSTFSGVQYVDGEYVYTNGSNSPGSVSKHSTGSYWKSPTWGVSSTDSRWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.78
4 0.83
5 0.84
6 0.79
7 0.77
8 0.75
9 0.69
10 0.66
11 0.56
12 0.49
13 0.4
14 0.36
15 0.28
16 0.2
17 0.14
18 0.06
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.07
28 0.1
29 0.12
30 0.15
31 0.18
32 0.19
33 0.21
34 0.22
35 0.21
36 0.24
37 0.28
38 0.32
39 0.32
40 0.31
41 0.32
42 0.32
43 0.34
44 0.33
45 0.3
46 0.26
47 0.28
48 0.32