Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395HJK9

Protein Details
Accession A0A395HJK9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-35SDSGSRNPRPSRRHACDRCRSQKLCCHydrophilic
67-89GRLRSSNPKARYRRKSNKMSDELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
Amino Acid Sequences MTQLPSGAASDSGSRNPRPSRRHACDRCRSQKLCCDRTAHCMNTSVACDCCARNHSTCVTSAPMPMGRLRSSNPKARYRRKSNKMSDELGSTTPPSCSTIQPPPDLAMARMEMDAVNDLPELYFTEGDLGYNLDFSNMNVFDTSAFADMVMSSQPEAVSPTNSAAVNPQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.33
3 0.41
4 0.49
5 0.52
6 0.6
7 0.65
8 0.7
9 0.79
10 0.82
11 0.84
12 0.86
13 0.9
14 0.89
15 0.88
16 0.82
17 0.77
18 0.75
19 0.75
20 0.7
21 0.64
22 0.59
23 0.52
24 0.57
25 0.58
26 0.52
27 0.43
28 0.41
29 0.37
30 0.34
31 0.34
32 0.27
33 0.2
34 0.19
35 0.18
36 0.15
37 0.17
38 0.18
39 0.2
40 0.2
41 0.23
42 0.24
43 0.24
44 0.24
45 0.23
46 0.23
47 0.19
48 0.18
49 0.17
50 0.15
51 0.15
52 0.16
53 0.16
54 0.15
55 0.15
56 0.17
57 0.25
58 0.28
59 0.36
60 0.4
61 0.47
62 0.56
63 0.65
64 0.73
65 0.74
66 0.8
67 0.81
68 0.85
69 0.84
70 0.84
71 0.79
72 0.71
73 0.61
74 0.52
75 0.45
76 0.35
77 0.27
78 0.18
79 0.14
80 0.11
81 0.11
82 0.11
83 0.11
84 0.12
85 0.16
86 0.22
87 0.25
88 0.26
89 0.26
90 0.24
91 0.25
92 0.24
93 0.2
94 0.14
95 0.12
96 0.12
97 0.11
98 0.1
99 0.08
100 0.08
101 0.08
102 0.07
103 0.06
104 0.06
105 0.06
106 0.05
107 0.06
108 0.07
109 0.07
110 0.07
111 0.06
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.07
118 0.07
119 0.07
120 0.06
121 0.06
122 0.07
123 0.12
124 0.11
125 0.12
126 0.11
127 0.12
128 0.11
129 0.12
130 0.13
131 0.08
132 0.08
133 0.07
134 0.07
135 0.07
136 0.08
137 0.07
138 0.07
139 0.06
140 0.07
141 0.07
142 0.07
143 0.11
144 0.12
145 0.13
146 0.14
147 0.16
148 0.18
149 0.18
150 0.18