Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HH47

Protein Details
Accession A0A395HH47    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTTPNNRPPPPPKNIRPLNRYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto_nucl 3, nucl 2.5, cyto 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013096  Cupin_2  
IPR047142  OryJ/VirC-like  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Pfam View protein in Pfam  
PF07883  Cupin_2  
CDD cd02231  cupin_BLL6423-like  
Amino Acid Sequences MTTPNNRPPPPPKNIRPLNRYITTHSLTTQKAIFSTTLPEEMPLQQINDSADAQFSLAYTTDSFPVDLAAERDIPAYSHYLSNPPGITISTGTVCRIVDMPPHALSPMHRTVSLDYGVVLEGEVELVLDSGETRLLKRGDVAVQRGTNHAWRNVTPDTVGADGEAVQNWARMLYVLSPAVGLGLGEDLGGIEVRDST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.8
4 0.79
5 0.78
6 0.74
7 0.69
8 0.65
9 0.62
10 0.55
11 0.49
12 0.44
13 0.41
14 0.34
15 0.34
16 0.3
17 0.23
18 0.21
19 0.21
20 0.19
21 0.14
22 0.18
23 0.17
24 0.17
25 0.16
26 0.16
27 0.16
28 0.17
29 0.19
30 0.16
31 0.15
32 0.13
33 0.15
34 0.15
35 0.15
36 0.14
37 0.11
38 0.1
39 0.1
40 0.09
41 0.08
42 0.07
43 0.06
44 0.05
45 0.06
46 0.07
47 0.08
48 0.09
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.09
60 0.08
61 0.08
62 0.08
63 0.09
64 0.09
65 0.1
66 0.1
67 0.12
68 0.13
69 0.15
70 0.14
71 0.12
72 0.12
73 0.1
74 0.11
75 0.09
76 0.09
77 0.08
78 0.08
79 0.08
80 0.09
81 0.08
82 0.08
83 0.08
84 0.08
85 0.09
86 0.1
87 0.12
88 0.12
89 0.12
90 0.12
91 0.11
92 0.12
93 0.15
94 0.18
95 0.16
96 0.16
97 0.17
98 0.18
99 0.2
100 0.2
101 0.14
102 0.1
103 0.09
104 0.09
105 0.08
106 0.07
107 0.04
108 0.03
109 0.03
110 0.03
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.03
117 0.03
118 0.05
119 0.05
120 0.06
121 0.11
122 0.11
123 0.11
124 0.13
125 0.15
126 0.19
127 0.23
128 0.26
129 0.27
130 0.28
131 0.29
132 0.3
133 0.29
134 0.29
135 0.28
136 0.29
137 0.27
138 0.25
139 0.3
140 0.3
141 0.29
142 0.24
143 0.22
144 0.2
145 0.18
146 0.17
147 0.11
148 0.1
149 0.09
150 0.1
151 0.09
152 0.08
153 0.07
154 0.08
155 0.08
156 0.08
157 0.07
158 0.07
159 0.08
160 0.08
161 0.12
162 0.11
163 0.11
164 0.11
165 0.11
166 0.11
167 0.1
168 0.07
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.05
177 0.04