Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IGC3

Protein Details
Accession A0A395IGC3   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-34QTINHLRVRRPNKHQGNPCVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPPKASTRLTPVRLQTINHLRVRRPNKHQGNPCVAIMSSMLSCWASAGATMEGCGALEQQLRACMDAPKPKAQGRSTINYHLMRMFPNVRGPQKKESVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.5
4 0.54
5 0.54
6 0.54
7 0.48
8 0.56
9 0.64
10 0.64
11 0.63
12 0.66
13 0.7
14 0.76
15 0.82
16 0.8
17 0.79
18 0.72
19 0.63
20 0.54
21 0.43
22 0.34
23 0.25
24 0.18
25 0.1
26 0.07
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.03
43 0.04
44 0.05
45 0.05
46 0.06
47 0.08
48 0.08
49 0.09
50 0.1
51 0.12
52 0.16
53 0.23
54 0.27
55 0.3
56 0.35
57 0.38
58 0.44
59 0.43
60 0.47
61 0.45
62 0.49
63 0.47
64 0.49
65 0.53
66 0.47
67 0.47
68 0.4
69 0.36
70 0.3
71 0.31
72 0.28
73 0.24
74 0.31
75 0.37
76 0.44
77 0.51
78 0.55
79 0.58
80 0.62