Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395I221

Protein Details
Accession A0A395I221    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33LLRQNEKHKPFMPPRKRFRKLYRDNIQGVHydrophilic
NLS Segment(s)
PositionSequence
18-21PRKR
Subcellular Location(s) nucl 16, cyto 5.5, mito 5, cyto_pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDVNLLRQNEKHKPFMPPRKRFRKLYRDNIQGVTRPAICRLARRGGVCRISADIYDEARRALKERLTEIIRRVVLVMDSATTHGHERKVVSTQDVIFVLNQMGNPIYGFHDRISRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.75
4 0.75
5 0.81
6 0.84
7 0.88
8 0.88
9 0.88
10 0.88
11 0.87
12 0.88
13 0.87
14 0.83
15 0.8
16 0.75
17 0.67
18 0.58
19 0.5
20 0.43
21 0.35
22 0.28
23 0.25
24 0.27
25 0.25
26 0.26
27 0.29
28 0.32
29 0.33
30 0.34
31 0.37
32 0.37
33 0.39
34 0.35
35 0.31
36 0.27
37 0.24
38 0.21
39 0.2
40 0.15
41 0.13
42 0.13
43 0.13
44 0.11
45 0.12
46 0.12
47 0.12
48 0.12
49 0.14
50 0.14
51 0.16
52 0.21
53 0.23
54 0.25
55 0.25
56 0.28
57 0.26
58 0.24
59 0.23
60 0.18
61 0.15
62 0.13
63 0.11
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.1
70 0.12
71 0.13
72 0.14
73 0.16
74 0.17
75 0.22
76 0.23
77 0.23
78 0.24
79 0.23
80 0.24
81 0.23
82 0.21
83 0.16
84 0.16
85 0.14
86 0.11
87 0.11
88 0.09
89 0.09
90 0.09
91 0.09
92 0.09
93 0.12
94 0.14
95 0.16
96 0.16