Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HTY1

Protein Details
Accession A0A395HTY1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-89DKTFEVVPSKKKKKNDIHKWLHydrophilic
NLS Segment(s)
PositionSequence
78-82KKKKK
Subcellular Location(s) mito 10, plas 6, mito_nucl 6, cyto 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLRSAGLIESGLAGVASFLALSDFGGFFALVSLCGMLGRHRKRIVYPRKHILVSTRTLNMKHRVHEKYDKTFEVVPSKKKKKNDIHKWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.02
5 0.02
6 0.03
7 0.03
8 0.03
9 0.04
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.07
24 0.17
25 0.2
26 0.26
27 0.28
28 0.29
29 0.34
30 0.44
31 0.51
32 0.52
33 0.56
34 0.58
35 0.59
36 0.59
37 0.55
38 0.5
39 0.43
40 0.37
41 0.33
42 0.3
43 0.28
44 0.29
45 0.34
46 0.37
47 0.36
48 0.37
49 0.43
50 0.42
51 0.48
52 0.56
53 0.57
54 0.58
55 0.61
56 0.57
57 0.52
58 0.52
59 0.49
60 0.49
61 0.48
62 0.48
63 0.53
64 0.62
65 0.66
66 0.7
67 0.77
68 0.78
69 0.83