Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NKA8

Protein Details
Accession B8NKA8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-44LAPGLWKHPRNKTDQYKKLSFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 22, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011251  Luciferase-like_dom  
IPR036661  Luciferase-like_sf  
IPR016215  NTA_MOA  
Gene Ontology GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF00296  Bac_luciferase  
Amino Acid Sequences MTNSDNNKKQIILNAFVMNTPGHLAPGLWKHPRNKTDQYKKLSFWTELAQLLDNAGFHAMFIADTLGPYDVYKGPANVVPTLASGAQFPVNDPLYLVPAMAAVTKNLIFGVTASVTYEKPYALARRLSTVDHLSEGRLAWNIVTSYLDSAARNHGLKEQIPHDERDAVRQIHHKGKYFEVPGPHFCEPSPQRTPFLFQAGVSEAGNGFGGKHGEAIFVGGQTPEGVRVTVDNIRKVAAEEGRDANHIKIIVGINAIVAATDEEAKAKREEYLRYADEEGALALFGGWTGVDLSGYTDDEDFRFSESPRVQSIVRRWSATVPGTENLPWTKRRIVEYLSVGGLGAKVVGSPTTVADELERWVEVAGVDGFNLAHITNPGTFEDIIEYLLPELRRRGRFRSVVGKEGATAREVFIGSRRLPEDHPGSKYGWHVGEKLPKYQLEEENREEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.35
4 0.34
5 0.25
6 0.2
7 0.18
8 0.14
9 0.11
10 0.1
11 0.1
12 0.15
13 0.22
14 0.29
15 0.35
16 0.41
17 0.48
18 0.58
19 0.64
20 0.66
21 0.7
22 0.74
23 0.77
24 0.8
25 0.81
26 0.79
27 0.75
28 0.75
29 0.69
30 0.6
31 0.51
32 0.46
33 0.41
34 0.36
35 0.35
36 0.28
37 0.23
38 0.22
39 0.2
40 0.15
41 0.11
42 0.1
43 0.08
44 0.06
45 0.07
46 0.06
47 0.05
48 0.05
49 0.07
50 0.06
51 0.06
52 0.07
53 0.07
54 0.08
55 0.08
56 0.11
57 0.11
58 0.14
59 0.16
60 0.15
61 0.17
62 0.19
63 0.21
64 0.19
65 0.18
66 0.15
67 0.14
68 0.15
69 0.14
70 0.12
71 0.1
72 0.1
73 0.12
74 0.11
75 0.12
76 0.16
77 0.16
78 0.16
79 0.16
80 0.15
81 0.15
82 0.15
83 0.14
84 0.08
85 0.08
86 0.08
87 0.09
88 0.09
89 0.06
90 0.08
91 0.09
92 0.09
93 0.08
94 0.08
95 0.07
96 0.07
97 0.09
98 0.08
99 0.07
100 0.08
101 0.1
102 0.1
103 0.12
104 0.12
105 0.09
106 0.1
107 0.14
108 0.17
109 0.2
110 0.24
111 0.24
112 0.27
113 0.29
114 0.29
115 0.28
116 0.27
117 0.24
118 0.21
119 0.21
120 0.17
121 0.17
122 0.16
123 0.13
124 0.11
125 0.1
126 0.08
127 0.09
128 0.09
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.1
135 0.09
136 0.1
137 0.13
138 0.16
139 0.16
140 0.16
141 0.18
142 0.19
143 0.21
144 0.23
145 0.23
146 0.28
147 0.29
148 0.3
149 0.28
150 0.31
151 0.3
152 0.31
153 0.33
154 0.26
155 0.27
156 0.31
157 0.35
158 0.37
159 0.41
160 0.41
161 0.37
162 0.4
163 0.43
164 0.4
165 0.38
166 0.35
167 0.35
168 0.33
169 0.37
170 0.34
171 0.29
172 0.26
173 0.33
174 0.29
175 0.33
176 0.37
177 0.32
178 0.34
179 0.35
180 0.39
181 0.31
182 0.33
183 0.26
184 0.19
185 0.19
186 0.18
187 0.18
188 0.15
189 0.13
190 0.08
191 0.08
192 0.08
193 0.06
194 0.05
195 0.04
196 0.05
197 0.05
198 0.06
199 0.06
200 0.06
201 0.06
202 0.07
203 0.06
204 0.06
205 0.06
206 0.05
207 0.04
208 0.04
209 0.05
210 0.04
211 0.04
212 0.04
213 0.04
214 0.05
215 0.07
216 0.12
217 0.14
218 0.15
219 0.15
220 0.15
221 0.16
222 0.16
223 0.17
224 0.14
225 0.13
226 0.14
227 0.15
228 0.16
229 0.17
230 0.17
231 0.14
232 0.13
233 0.12
234 0.1
235 0.11
236 0.1
237 0.09
238 0.09
239 0.08
240 0.07
241 0.07
242 0.07
243 0.04
244 0.03
245 0.03
246 0.03
247 0.04
248 0.04
249 0.05
250 0.06
251 0.08
252 0.09
253 0.09
254 0.12
255 0.15
256 0.18
257 0.2
258 0.26
259 0.25
260 0.27
261 0.28
262 0.25
263 0.22
264 0.19
265 0.15
266 0.09
267 0.08
268 0.05
269 0.03
270 0.03
271 0.02
272 0.02
273 0.02
274 0.02
275 0.03
276 0.03
277 0.03
278 0.03
279 0.05
280 0.06
281 0.06
282 0.06
283 0.06
284 0.07
285 0.07
286 0.09
287 0.08
288 0.1
289 0.11
290 0.11
291 0.18
292 0.2
293 0.22
294 0.22
295 0.25
296 0.23
297 0.28
298 0.34
299 0.36
300 0.36
301 0.35
302 0.34
303 0.35
304 0.39
305 0.35
306 0.31
307 0.25
308 0.23
309 0.23
310 0.23
311 0.23
312 0.21
313 0.23
314 0.22
315 0.23
316 0.27
317 0.29
318 0.33
319 0.34
320 0.34
321 0.37
322 0.39
323 0.37
324 0.32
325 0.28
326 0.24
327 0.2
328 0.17
329 0.1
330 0.07
331 0.04
332 0.03
333 0.04
334 0.04
335 0.04
336 0.05
337 0.06
338 0.08
339 0.09
340 0.09
341 0.1
342 0.1
343 0.11
344 0.12
345 0.11
346 0.09
347 0.08
348 0.09
349 0.07
350 0.09
351 0.09
352 0.07
353 0.07
354 0.08
355 0.07
356 0.07
357 0.08
358 0.05
359 0.05
360 0.06
361 0.08
362 0.09
363 0.11
364 0.12
365 0.14
366 0.14
367 0.13
368 0.15
369 0.13
370 0.13
371 0.11
372 0.11
373 0.09
374 0.13
375 0.13
376 0.13
377 0.2
378 0.27
379 0.35
380 0.4
381 0.46
382 0.53
383 0.58
384 0.62
385 0.66
386 0.63
387 0.62
388 0.6
389 0.53
390 0.46
391 0.44
392 0.38
393 0.29
394 0.25
395 0.19
396 0.19
397 0.18
398 0.17
399 0.17
400 0.23
401 0.22
402 0.27
403 0.29
404 0.29
405 0.31
406 0.38
407 0.42
408 0.43
409 0.45
410 0.42
411 0.42
412 0.42
413 0.43
414 0.41
415 0.37
416 0.33
417 0.32
418 0.36
419 0.45
420 0.45
421 0.48
422 0.47
423 0.45
424 0.48
425 0.52
426 0.54
427 0.54
428 0.58