Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HNU3

Protein Details
Accession A0A395HNU3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-32LSPHACKSNTESRKKRWKEHYTISSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MWRKRKLSPHACKSNTESRKKRWKEHYTISSSDDSDDSEHQSETLADDEYYINCILDETDTQYLIDWEGPWEPTWEPKEHASALAVQVWEQKKQQERRTQSEETQPPGFRACCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.73
3 0.73
4 0.7
5 0.69
6 0.78
7 0.8
8 0.83
9 0.83
10 0.84
11 0.82
12 0.84
13 0.84
14 0.79
15 0.74
16 0.68
17 0.6
18 0.5
19 0.41
20 0.31
21 0.22
22 0.18
23 0.16
24 0.15
25 0.14
26 0.13
27 0.12
28 0.12
29 0.11
30 0.1
31 0.1
32 0.07
33 0.06
34 0.07
35 0.08
36 0.07
37 0.09
38 0.08
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.07
52 0.08
53 0.05
54 0.05
55 0.06
56 0.07
57 0.07
58 0.09
59 0.09
60 0.14
61 0.17
62 0.18
63 0.2
64 0.21
65 0.24
66 0.23
67 0.23
68 0.19
69 0.17
70 0.17
71 0.17
72 0.15
73 0.12
74 0.18
75 0.19
76 0.21
77 0.21
78 0.26
79 0.33
80 0.43
81 0.51
82 0.55
83 0.62
84 0.68
85 0.73
86 0.73
87 0.69
88 0.7
89 0.67
90 0.63
91 0.61
92 0.54
93 0.48
94 0.48