Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395I9H8

Protein Details
Accession A0A395I9H8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGQRHNRRRTRPRSRNRSSSSIHHydrophilic
NLS Segment(s)
PositionSequence
7-15RRRTRPRSR
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MGQRHNRRRTRPRSRNRSSSSIHNNHIQIAPNEAFTRPTNSVLPAAFDCHEPPAPTWHYGNITWQNRDRMMRLETSNLEAEQCRLFGGEPGDDVGLCYRMLEYFGGLDYIDCPQSLNALPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.89
4 0.86
5 0.78
6 0.77
7 0.77
8 0.72
9 0.66
10 0.61
11 0.55
12 0.5
13 0.48
14 0.41
15 0.31
16 0.3
17 0.27
18 0.22
19 0.22
20 0.2
21 0.2
22 0.18
23 0.23
24 0.19
25 0.21
26 0.2
27 0.2
28 0.22
29 0.19
30 0.2
31 0.15
32 0.16
33 0.14
34 0.14
35 0.13
36 0.13
37 0.14
38 0.12
39 0.13
40 0.16
41 0.17
42 0.18
43 0.18
44 0.17
45 0.19
46 0.18
47 0.23
48 0.26
49 0.27
50 0.28
51 0.31
52 0.32
53 0.32
54 0.33
55 0.29
56 0.24
57 0.24
58 0.24
59 0.22
60 0.23
61 0.22
62 0.23
63 0.23
64 0.19
65 0.18
66 0.14
67 0.15
68 0.12
69 0.11
70 0.08
71 0.08
72 0.08
73 0.09
74 0.11
75 0.1
76 0.09
77 0.1
78 0.1
79 0.1
80 0.1
81 0.09
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.08
88 0.08
89 0.08
90 0.07
91 0.08
92 0.08
93 0.08
94 0.08
95 0.07
96 0.1
97 0.1
98 0.09
99 0.09
100 0.09
101 0.12