Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HYJ0

Protein Details
Accession A0A395HYJ0   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-40TSSSSSPQAPKQSKKAKKQQKQQKKSQNPSSAPKESHydrophilic
NLS Segment(s)
PositionSequence
15-29KQSKKAKKQQKQQKK
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024320  LPG_synthase_C  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF09924  LPG_synthase_C  
Amino Acid Sequences MSTTTSSSSSPQAPKQSKKAKKQQKQQKKSQNPSSAPKESAKVLLADTIGKALHERLLSFGARRHHNPQQQQEHHDWDTHLDSRLLSASPYLTVPHIPRTSSSSSSSSISRGSSSITLSSCDGRSVASSRTSHESNPIDKPYMSSVSLHSDVLTSRIVTLNGPCTMETIQHLVSRYGQVSHMGVLDPSYSLFVNRSRTAVLCFKVLNKVAVVSGDPMCAAEQFGPLLSEFQTYRKSRRLGIAFLGTSERMVHYAHRTQSLHAKQNWTLLEFAKERVLNPTTNAVLLEQSGKRIVMQNKQLLNPSKGGITLDVYVPPERSSSSSVSVSTEGEPSSSSEDLQSQLHAIYTNWCDHRNTTATTTTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.75
4 0.77
5 0.82
6 0.87
7 0.87
8 0.89
9 0.91
10 0.92
11 0.93
12 0.93
13 0.93
14 0.94
15 0.94
16 0.94
17 0.94
18 0.93
19 0.88
20 0.87
21 0.85
22 0.8
23 0.73
24 0.65
25 0.57
26 0.49
27 0.46
28 0.38
29 0.3
30 0.25
31 0.23
32 0.2
33 0.18
34 0.16
35 0.14
36 0.12
37 0.11
38 0.12
39 0.1
40 0.13
41 0.13
42 0.13
43 0.14
44 0.18
45 0.19
46 0.2
47 0.23
48 0.26
49 0.31
50 0.36
51 0.41
52 0.46
53 0.54
54 0.61
55 0.67
56 0.71
57 0.71
58 0.73
59 0.71
60 0.68
61 0.61
62 0.55
63 0.45
64 0.37
65 0.35
66 0.31
67 0.28
68 0.21
69 0.19
70 0.18
71 0.19
72 0.16
73 0.12
74 0.1
75 0.09
76 0.09
77 0.1
78 0.1
79 0.09
80 0.12
81 0.14
82 0.21
83 0.22
84 0.22
85 0.22
86 0.27
87 0.31
88 0.3
89 0.32
90 0.27
91 0.28
92 0.29
93 0.28
94 0.24
95 0.21
96 0.19
97 0.16
98 0.14
99 0.14
100 0.13
101 0.13
102 0.15
103 0.13
104 0.14
105 0.14
106 0.16
107 0.14
108 0.13
109 0.12
110 0.1
111 0.11
112 0.12
113 0.13
114 0.17
115 0.17
116 0.19
117 0.24
118 0.25
119 0.23
120 0.28
121 0.3
122 0.29
123 0.33
124 0.33
125 0.3
126 0.29
127 0.3
128 0.25
129 0.24
130 0.21
131 0.17
132 0.16
133 0.19
134 0.2
135 0.18
136 0.15
137 0.13
138 0.13
139 0.13
140 0.12
141 0.08
142 0.07
143 0.08
144 0.08
145 0.08
146 0.1
147 0.11
148 0.12
149 0.12
150 0.11
151 0.12
152 0.12
153 0.12
154 0.12
155 0.11
156 0.11
157 0.12
158 0.13
159 0.12
160 0.13
161 0.13
162 0.13
163 0.11
164 0.1
165 0.1
166 0.09
167 0.09
168 0.09
169 0.07
170 0.07
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.04
177 0.05
178 0.06
179 0.09
180 0.13
181 0.14
182 0.15
183 0.15
184 0.15
185 0.19
186 0.22
187 0.2
188 0.17
189 0.17
190 0.18
191 0.21
192 0.22
193 0.19
194 0.15
195 0.14
196 0.13
197 0.12
198 0.12
199 0.09
200 0.09
201 0.08
202 0.08
203 0.07
204 0.07
205 0.07
206 0.07
207 0.05
208 0.05
209 0.05
210 0.05
211 0.06
212 0.06
213 0.06
214 0.06
215 0.08
216 0.08
217 0.1
218 0.19
219 0.2
220 0.25
221 0.31
222 0.33
223 0.34
224 0.42
225 0.43
226 0.38
227 0.39
228 0.39
229 0.32
230 0.31
231 0.29
232 0.21
233 0.18
234 0.16
235 0.12
236 0.08
237 0.09
238 0.11
239 0.15
240 0.21
241 0.23
242 0.28
243 0.29
244 0.3
245 0.39
246 0.44
247 0.46
248 0.44
249 0.47
250 0.42
251 0.47
252 0.46
253 0.38
254 0.33
255 0.25
256 0.27
257 0.24
258 0.23
259 0.23
260 0.22
261 0.21
262 0.26
263 0.27
264 0.23
265 0.23
266 0.26
267 0.22
268 0.22
269 0.21
270 0.16
271 0.14
272 0.14
273 0.17
274 0.13
275 0.14
276 0.15
277 0.14
278 0.15
279 0.22
280 0.27
281 0.3
282 0.38
283 0.44
284 0.47
285 0.49
286 0.55
287 0.54
288 0.51
289 0.45
290 0.38
291 0.31
292 0.28
293 0.26
294 0.2
295 0.17
296 0.15
297 0.14
298 0.15
299 0.17
300 0.17
301 0.17
302 0.17
303 0.15
304 0.16
305 0.17
306 0.2
307 0.21
308 0.23
309 0.24
310 0.24
311 0.26
312 0.26
313 0.24
314 0.22
315 0.2
316 0.16
317 0.15
318 0.15
319 0.14
320 0.17
321 0.16
322 0.15
323 0.15
324 0.16
325 0.18
326 0.18
327 0.17
328 0.13
329 0.13
330 0.14
331 0.13
332 0.12
333 0.16
334 0.19
335 0.25
336 0.27
337 0.3
338 0.31
339 0.32
340 0.4
341 0.38
342 0.39
343 0.36