Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395HGP8

Protein Details
Accession A0A395HGP8    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-25ACSSCRFRKRKCMVLAPGKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences MRPTSACSSCRFRKRKCMVLAPGKPGHLCSSKNWLCDLQALSVSVSISRNPDLQPESDQTFYNKLPQDVCNELADLYLKLVHTKQYTSSTITLSSKNNARVEFQPIYFWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.79
4 0.79
5 0.79
6 0.81
7 0.8
8 0.76
9 0.71
10 0.63
11 0.55
12 0.46
13 0.41
14 0.35
15 0.3
16 0.26
17 0.33
18 0.34
19 0.35
20 0.36
21 0.31
22 0.28
23 0.3
24 0.28
25 0.19
26 0.16
27 0.16
28 0.14
29 0.13
30 0.13
31 0.1
32 0.09
33 0.08
34 0.09
35 0.1
36 0.11
37 0.11
38 0.13
39 0.14
40 0.14
41 0.16
42 0.17
43 0.18
44 0.18
45 0.18
46 0.16
47 0.18
48 0.17
49 0.21
50 0.2
51 0.19
52 0.2
53 0.21
54 0.24
55 0.24
56 0.25
57 0.2
58 0.19
59 0.17
60 0.16
61 0.15
62 0.11
63 0.08
64 0.08
65 0.07
66 0.09
67 0.1
68 0.14
69 0.15
70 0.16
71 0.19
72 0.23
73 0.25
74 0.28
75 0.29
76 0.26
77 0.28
78 0.29
79 0.29
80 0.26
81 0.3
82 0.32
83 0.37
84 0.4
85 0.37
86 0.39
87 0.39
88 0.44
89 0.42
90 0.37