Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395I916

Protein Details
Accession A0A395I916   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-34PDQPTQSPDPKRRRLAPPSRLEAHydrophilic
155-175LIPLQIKLLRRKRREGDNTAPHydrophilic
NLS Segment(s)
PositionSequence
164-167RRKR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR047134  RNF4-like  
IPR018957  Znf_C3HC4_RING-type  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0016740  F:transferase activity  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF00097  zf-C3HC4  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MDFPRYSPESTPDQPTQSPDPKRRRLAPPSRLEAVQLEGQSSEVTSVDLTENEEVSEISKTQAKQRADAILAQQSLEPKNTESIFAAYKCPVCMDTPVDATSTVCGHLFCHKCITDTLKFSEERSVSTSKAPKGTCPVCRKPLSRNDVSGPKRHLIPLQIKLLRRKRREGDNTAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.48
4 0.49
5 0.55
6 0.58
7 0.64
8 0.69
9 0.75
10 0.78
11 0.79
12 0.81
13 0.82
14 0.82
15 0.81
16 0.78
17 0.74
18 0.66
19 0.57
20 0.48
21 0.4
22 0.34
23 0.25
24 0.19
25 0.15
26 0.15
27 0.14
28 0.12
29 0.09
30 0.06
31 0.06
32 0.05
33 0.06
34 0.06
35 0.07
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.07
42 0.08
43 0.08
44 0.07
45 0.07
46 0.11
47 0.12
48 0.18
49 0.26
50 0.25
51 0.27
52 0.29
53 0.31
54 0.29
55 0.29
56 0.25
57 0.21
58 0.21
59 0.19
60 0.17
61 0.16
62 0.15
63 0.15
64 0.13
65 0.1
66 0.13
67 0.13
68 0.13
69 0.11
70 0.12
71 0.13
72 0.13
73 0.14
74 0.12
75 0.12
76 0.11
77 0.11
78 0.1
79 0.09
80 0.1
81 0.11
82 0.12
83 0.13
84 0.13
85 0.13
86 0.13
87 0.12
88 0.11
89 0.09
90 0.08
91 0.07
92 0.06
93 0.07
94 0.15
95 0.17
96 0.17
97 0.21
98 0.21
99 0.22
100 0.24
101 0.3
102 0.26
103 0.27
104 0.3
105 0.28
106 0.29
107 0.28
108 0.33
109 0.27
110 0.24
111 0.25
112 0.24
113 0.22
114 0.28
115 0.32
116 0.29
117 0.35
118 0.33
119 0.32
120 0.39
121 0.44
122 0.47
123 0.51
124 0.56
125 0.58
126 0.65
127 0.65
128 0.65
129 0.69
130 0.68
131 0.64
132 0.61
133 0.59
134 0.62
135 0.62
136 0.61
137 0.56
138 0.51
139 0.48
140 0.46
141 0.43
142 0.41
143 0.46
144 0.45
145 0.5
146 0.52
147 0.55
148 0.63
149 0.7
150 0.72
151 0.7
152 0.73
153 0.71
154 0.77
155 0.81