Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395HNE7

Protein Details
Accession A0A395HNE7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-33NVRTIRGRHSDNPRSKRQQRLRRRLRLMFGAHydrophilic
NLS Segment(s)
PositionSequence
16-26RSKRQQRLRRR
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MANVRTIRGRHSDNPRSKRQQRLRRRLRLMFGAFEYCHECDADISLLIRLKDTGQIYIFNSDSQWQPSKEQLASYYPKPKQVTWEELASKYRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.8
4 0.81
5 0.84
6 0.84
7 0.84
8 0.85
9 0.89
10 0.9
11 0.9
12 0.91
13 0.86
14 0.8
15 0.78
16 0.69
17 0.61
18 0.51
19 0.44
20 0.35
21 0.3
22 0.27
23 0.19
24 0.17
25 0.14
26 0.12
27 0.09
28 0.1
29 0.09
30 0.06
31 0.06
32 0.07
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.11
39 0.11
40 0.12
41 0.11
42 0.13
43 0.14
44 0.17
45 0.17
46 0.13
47 0.12
48 0.12
49 0.13
50 0.16
51 0.19
52 0.18
53 0.2
54 0.23
55 0.27
56 0.26
57 0.26
58 0.25
59 0.27
60 0.3
61 0.34
62 0.4
63 0.38
64 0.45
65 0.47
66 0.46
67 0.48
68 0.51
69 0.53
70 0.47
71 0.53
72 0.49
73 0.5