Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395HF12

Protein Details
Accession A0A395HF12    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-55KAFFSWRCGRQRSKKGRRTPGIKYKTHydrophilic
NLS Segment(s)
PositionSequence
41-47RSKKGRR
Subcellular Location(s) cyto 10.5, mito 9, cyto_nucl 9, nucl 6.5
Family & Domain DBs
Amino Acid Sequences LARFCYEGKHDPVERFGWLSDSEETIRFLKAFFSWRCGRQRSKKGRRTPGIKYKTSLETFWKWWHLVYKAEVGQGLSKDTTVKILDLLAMVAKERNLLSGRRPKATMYIEDVAEFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.28
4 0.22
5 0.19
6 0.2
7 0.17
8 0.18
9 0.18
10 0.17
11 0.19
12 0.18
13 0.18
14 0.15
15 0.14
16 0.12
17 0.13
18 0.19
19 0.18
20 0.23
21 0.27
22 0.33
23 0.4
24 0.45
25 0.53
26 0.55
27 0.65
28 0.7
29 0.77
30 0.8
31 0.83
32 0.87
33 0.87
34 0.83
35 0.82
36 0.81
37 0.77
38 0.7
39 0.62
40 0.55
41 0.52
42 0.47
43 0.39
44 0.33
45 0.28
46 0.29
47 0.29
48 0.28
49 0.22
50 0.22
51 0.24
52 0.21
53 0.21
54 0.2
55 0.22
56 0.21
57 0.21
58 0.21
59 0.17
60 0.17
61 0.15
62 0.15
63 0.1
64 0.1
65 0.1
66 0.1
67 0.12
68 0.1
69 0.1
70 0.09
71 0.09
72 0.09
73 0.08
74 0.08
75 0.07
76 0.06
77 0.06
78 0.07
79 0.07
80 0.08
81 0.08
82 0.12
83 0.13
84 0.15
85 0.24
86 0.33
87 0.38
88 0.4
89 0.41
90 0.39
91 0.45
92 0.48
93 0.44
94 0.41
95 0.4
96 0.36