Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395HV64

Protein Details
Accession A0A395HV64    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
184-209HNIAAKLSPQRRKKKKGKGKAAAGYVHydrophilic
NLS Segment(s)
PositionSequence
192-204PQRRKKKKGKGKA
Subcellular Location(s) extr 24, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSHSRGSIAHSLWQYGLLFSVCLQTSAAGDSDSPSNSRNGYSHGQPIPVTCLNRTIDSGEHITDTQGHLQYIPFPTCNETSLPLALHYGVSETVNCTIASLPDELYHLLEYYVHSDVPMTCRVPTAPLAQHLLSTPETDADEPAASNDIDTDGPSYTPLTFALQGTLQRSHLHIWTDMNLLVHNIAAKLSPQRRKKKKGKGKAAAGYVVAGTAYSVPEFDVIIQKQMQQKHTSDEEKAASAAVAVAAKDPWTAGHGTKVIRGEPLTFSFHVSWVEGGRGIGWPASGLRSVGAGSGGEGEGGTGFFSRLLFFVMAAGVGAVVALYWERNGGSLGMRRRRDEGILGVSASSRGKTGNGAVGITYGNGGRMNGYGGYSSAGTGATAGDGAGGVYGYGGYTGSGKRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.27
3 0.2
4 0.2
5 0.13
6 0.12
7 0.11
8 0.16
9 0.13
10 0.13
11 0.13
12 0.12
13 0.13
14 0.14
15 0.14
16 0.09
17 0.09
18 0.11
19 0.13
20 0.14
21 0.15
22 0.14
23 0.16
24 0.17
25 0.2
26 0.19
27 0.22
28 0.25
29 0.28
30 0.35
31 0.35
32 0.36
33 0.35
34 0.35
35 0.36
36 0.36
37 0.34
38 0.27
39 0.31
40 0.3
41 0.31
42 0.31
43 0.26
44 0.23
45 0.25
46 0.26
47 0.21
48 0.2
49 0.19
50 0.18
51 0.17
52 0.18
53 0.2
54 0.19
55 0.18
56 0.17
57 0.17
58 0.22
59 0.24
60 0.24
61 0.2
62 0.19
63 0.23
64 0.23
65 0.24
66 0.21
67 0.19
68 0.19
69 0.2
70 0.19
71 0.15
72 0.15
73 0.14
74 0.13
75 0.1
76 0.09
77 0.08
78 0.08
79 0.08
80 0.09
81 0.1
82 0.11
83 0.11
84 0.1
85 0.1
86 0.1
87 0.12
88 0.11
89 0.1
90 0.1
91 0.11
92 0.11
93 0.11
94 0.11
95 0.09
96 0.08
97 0.08
98 0.08
99 0.1
100 0.11
101 0.09
102 0.09
103 0.1
104 0.11
105 0.14
106 0.17
107 0.15
108 0.14
109 0.15
110 0.15
111 0.17
112 0.18
113 0.2
114 0.19
115 0.21
116 0.24
117 0.23
118 0.23
119 0.21
120 0.22
121 0.17
122 0.15
123 0.13
124 0.1
125 0.11
126 0.11
127 0.11
128 0.09
129 0.09
130 0.08
131 0.08
132 0.08
133 0.07
134 0.07
135 0.06
136 0.07
137 0.06
138 0.07
139 0.07
140 0.06
141 0.07
142 0.07
143 0.08
144 0.07
145 0.07
146 0.07
147 0.08
148 0.09
149 0.09
150 0.09
151 0.1
152 0.11
153 0.14
154 0.14
155 0.14
156 0.13
157 0.15
158 0.15
159 0.16
160 0.16
161 0.15
162 0.14
163 0.15
164 0.16
165 0.15
166 0.13
167 0.11
168 0.1
169 0.09
170 0.08
171 0.06
172 0.05
173 0.04
174 0.04
175 0.05
176 0.12
177 0.19
178 0.27
179 0.36
180 0.47
181 0.57
182 0.67
183 0.77
184 0.81
185 0.85
186 0.88
187 0.9
188 0.88
189 0.87
190 0.82
191 0.74
192 0.64
193 0.53
194 0.42
195 0.31
196 0.21
197 0.12
198 0.06
199 0.04
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.04
206 0.04
207 0.05
208 0.09
209 0.09
210 0.11
211 0.12
212 0.15
213 0.2
214 0.24
215 0.26
216 0.26
217 0.27
218 0.29
219 0.34
220 0.33
221 0.3
222 0.3
223 0.27
224 0.24
225 0.23
226 0.18
227 0.12
228 0.1
229 0.08
230 0.05
231 0.05
232 0.04
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.04
239 0.06
240 0.08
241 0.08
242 0.11
243 0.14
244 0.14
245 0.18
246 0.19
247 0.18
248 0.18
249 0.18
250 0.17
251 0.16
252 0.18
253 0.19
254 0.18
255 0.2
256 0.19
257 0.2
258 0.18
259 0.16
260 0.14
261 0.11
262 0.11
263 0.09
264 0.08
265 0.08
266 0.08
267 0.08
268 0.07
269 0.06
270 0.06
271 0.06
272 0.07
273 0.07
274 0.07
275 0.07
276 0.07
277 0.07
278 0.07
279 0.07
280 0.06
281 0.05
282 0.06
283 0.06
284 0.05
285 0.05
286 0.05
287 0.05
288 0.05
289 0.05
290 0.04
291 0.04
292 0.05
293 0.05
294 0.06
295 0.06
296 0.08
297 0.08
298 0.07
299 0.08
300 0.07
301 0.07
302 0.06
303 0.06
304 0.03
305 0.03
306 0.03
307 0.02
308 0.02
309 0.02
310 0.02
311 0.03
312 0.03
313 0.04
314 0.04
315 0.05
316 0.06
317 0.07
318 0.11
319 0.17
320 0.26
321 0.34
322 0.38
323 0.4
324 0.43
325 0.45
326 0.44
327 0.41
328 0.38
329 0.34
330 0.31
331 0.29
332 0.26
333 0.23
334 0.22
335 0.2
336 0.14
337 0.1
338 0.09
339 0.1
340 0.12
341 0.15
342 0.18
343 0.19
344 0.19
345 0.18
346 0.18
347 0.18
348 0.15
349 0.14
350 0.08
351 0.08
352 0.09
353 0.09
354 0.09
355 0.09
356 0.11
357 0.11
358 0.11
359 0.1
360 0.1
361 0.11
362 0.11
363 0.1
364 0.09
365 0.08
366 0.07
367 0.07
368 0.07
369 0.05
370 0.05
371 0.05
372 0.04
373 0.04
374 0.04
375 0.04
376 0.04
377 0.03
378 0.03
379 0.03
380 0.03
381 0.04
382 0.04
383 0.04
384 0.07