Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HT84

Protein Details
Accession A0A395HT84   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
174-199SKTNRTAKPRGVIKKKLPKPKVSLGSHydrophilic
NLS Segment(s)
PositionSequence
178-214RTAKPRGVIKKKLPKPKVSLGSPPFTRSAAKRNQQKR
Subcellular Location(s) nucl 13, cyto_nucl 11.333, cyto 7.5, cyto_mito 6.666, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001394  Peptidase_C19_UCH  
IPR018200  USP_CS  
IPR028889  USP_dom  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00443  UCH  
PROSITE View protein in PROSITE  
PS00973  USP_2  
PS50235  USP_3  
CDD cd02257  Peptidase_C19  
Amino Acid Sequences MDMAHYQLYAFVSHLGSNIDSGHYICFAESPHGQWASFNDDAVSAKTVSDLKSSDEIRKDVYLLAYRRTEPLPEQWASPAATRHVDKDSPATRPSSGVTLDETIKFEGRTVQWTFKQQLTPPAECESLVQLRSAKARVQQAQVKIKLTSTTGEVLEGQGTIPLRPDIIPAQPVSKTNRTAKPRGVIKKKLPKPKVSLGSPPFTRSAAKRNQQKRGVAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.12
6 0.11
7 0.1
8 0.11
9 0.11
10 0.1
11 0.1
12 0.09
13 0.09
14 0.09
15 0.13
16 0.13
17 0.15
18 0.2
19 0.21
20 0.21
21 0.21
22 0.23
23 0.25
24 0.25
25 0.22
26 0.17
27 0.16
28 0.18
29 0.18
30 0.18
31 0.1
32 0.1
33 0.12
34 0.13
35 0.13
36 0.15
37 0.14
38 0.15
39 0.2
40 0.23
41 0.26
42 0.28
43 0.28
44 0.28
45 0.28
46 0.25
47 0.21
48 0.22
49 0.23
50 0.21
51 0.25
52 0.25
53 0.25
54 0.27
55 0.26
56 0.25
57 0.2
58 0.25
59 0.26
60 0.24
61 0.24
62 0.23
63 0.24
64 0.23
65 0.23
66 0.18
67 0.14
68 0.17
69 0.17
70 0.19
71 0.2
72 0.19
73 0.18
74 0.24
75 0.25
76 0.25
77 0.26
78 0.25
79 0.22
80 0.22
81 0.22
82 0.17
83 0.15
84 0.12
85 0.12
86 0.12
87 0.13
88 0.12
89 0.13
90 0.11
91 0.11
92 0.11
93 0.09
94 0.11
95 0.1
96 0.14
97 0.15
98 0.18
99 0.2
100 0.24
101 0.26
102 0.25
103 0.27
104 0.24
105 0.3
106 0.32
107 0.31
108 0.29
109 0.29
110 0.27
111 0.25
112 0.24
113 0.19
114 0.16
115 0.15
116 0.14
117 0.13
118 0.14
119 0.16
120 0.17
121 0.15
122 0.18
123 0.24
124 0.27
125 0.32
126 0.36
127 0.41
128 0.48
129 0.49
130 0.46
131 0.4
132 0.37
133 0.32
134 0.28
135 0.22
136 0.15
137 0.15
138 0.13
139 0.13
140 0.12
141 0.12
142 0.11
143 0.1
144 0.08
145 0.07
146 0.08
147 0.07
148 0.08
149 0.08
150 0.08
151 0.09
152 0.11
153 0.11
154 0.13
155 0.16
156 0.15
157 0.18
158 0.19
159 0.22
160 0.27
161 0.3
162 0.34
163 0.4
164 0.48
165 0.53
166 0.57
167 0.6
168 0.62
169 0.66
170 0.7
171 0.72
172 0.73
173 0.76
174 0.81
175 0.84
176 0.86
177 0.84
178 0.82
179 0.8
180 0.81
181 0.79
182 0.74
183 0.75
184 0.7
185 0.7
186 0.64
187 0.59
188 0.51
189 0.44
190 0.43
191 0.37
192 0.41
193 0.43
194 0.5
195 0.57
196 0.65
197 0.73
198 0.76