Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IDF1

Protein Details
Accession A0A395IDF1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
48-69PSPSFRGRSPPQRYRPRPRSYGHydrophilic
NLS Segment(s)
PositionSequence
43-81RRSPSPSPSFRGRSPPQRYRPRPRSYGPGWRPSRRFGSR
Subcellular Location(s) cyto 14, cyto_nucl 12, nucl 8, mito 2, cysk 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDGASAIFAFVQVGLSIATTLNTYIADVRHRRDDIANREGPVRRSPSPSPSFRGRSPPQRYRPRPRSYGPGWRPSRRFGSRSRSYVRERMDPGAGQRVYAEEVTESEESGDEGPPDDVLVDRIMTRYTGQPIERNVGTEGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.05
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.08
12 0.09
13 0.17
14 0.2
15 0.23
16 0.3
17 0.3
18 0.32
19 0.37
20 0.44
21 0.44
22 0.49
23 0.48
24 0.42
25 0.46
26 0.47
27 0.43
28 0.4
29 0.38
30 0.32
31 0.36
32 0.37
33 0.42
34 0.46
35 0.46
36 0.46
37 0.48
38 0.5
39 0.46
40 0.52
41 0.49
42 0.53
43 0.59
44 0.64
45 0.66
46 0.73
47 0.8
48 0.82
49 0.86
50 0.82
51 0.78
52 0.71
53 0.69
54 0.63
55 0.65
56 0.59
57 0.59
58 0.58
59 0.59
60 0.58
61 0.54
62 0.57
63 0.51
64 0.5
65 0.47
66 0.51
67 0.52
68 0.56
69 0.56
70 0.54
71 0.54
72 0.57
73 0.53
74 0.5
75 0.45
76 0.42
77 0.39
78 0.34
79 0.31
80 0.33
81 0.29
82 0.23
83 0.2
84 0.19
85 0.18
86 0.17
87 0.16
88 0.07
89 0.08
90 0.12
91 0.11
92 0.1
93 0.09
94 0.09
95 0.09
96 0.1
97 0.1
98 0.06
99 0.07
100 0.08
101 0.07
102 0.07
103 0.07
104 0.06
105 0.07
106 0.08
107 0.07
108 0.07
109 0.09
110 0.09
111 0.1
112 0.12
113 0.14
114 0.18
115 0.23
116 0.26
117 0.3
118 0.33
119 0.39
120 0.37
121 0.36