Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

D6RJN3

Protein Details
Accession D6RJN3   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-35IAKWTPEWKRDRKGRVHKRDHMWDQDBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG cci:CC1G_13572  -  
Amino Acid Sequences MDSQSVVDGIAKWTPEWKRDRKGRVHKRDHMWDQDLWDALRFWDIPRDWNEADEFAKEVVWISKQKGKKRANVFPFELEILPTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.36
4 0.42
5 0.5
6 0.59
7 0.68
8 0.71
9 0.8
10 0.83
11 0.85
12 0.87
13 0.86
14 0.85
15 0.86
16 0.81
17 0.77
18 0.69
19 0.59
20 0.51
21 0.44
22 0.37
23 0.27
24 0.21
25 0.14
26 0.1
27 0.11
28 0.08
29 0.07
30 0.11
31 0.12
32 0.14
33 0.18
34 0.23
35 0.22
36 0.23
37 0.24
38 0.2
39 0.2
40 0.17
41 0.15
42 0.09
43 0.09
44 0.08
45 0.08
46 0.08
47 0.11
48 0.13
49 0.16
50 0.23
51 0.29
52 0.38
53 0.47
54 0.53
55 0.59
56 0.66
57 0.73
58 0.75
59 0.76
60 0.72
61 0.66
62 0.62
63 0.55
64 0.46