Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HPK3

Protein Details
Accession A0A395HPK3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-28IIAANLRNNRQKPRRRDLNLLRKLHRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR005000  Aldolase/citrate-lyase_domain  
IPR015813  Pyrv/PenolPyrv_Kinase-like_dom  
IPR040442  Pyrv_Kinase-like_dom_sf  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF03328  HpcH_HpaI  
Amino Acid Sequences MIIIAANLRNNRQKPRRRDLNLLRKLHRTPAATCHLGKQALEVHEIVAASAGCGVSPVVRVAEGQAWMIKRALDAGAHGILVPMLETADEARRYTESGFLMPSAMTDMIGLSQVFRQAFEGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.77
3 0.82
4 0.8
5 0.86
6 0.86
7 0.87
8 0.87
9 0.85
10 0.78
11 0.74
12 0.69
13 0.65
14 0.6
15 0.52
16 0.45
17 0.45
18 0.47
19 0.43
20 0.42
21 0.38
22 0.36
23 0.33
24 0.3
25 0.25
26 0.23
27 0.21
28 0.22
29 0.19
30 0.15
31 0.15
32 0.15
33 0.12
34 0.08
35 0.07
36 0.05
37 0.05
38 0.05
39 0.03
40 0.04
41 0.04
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.07
51 0.06
52 0.08
53 0.08
54 0.09
55 0.1
56 0.09
57 0.07
58 0.08
59 0.08
60 0.06
61 0.06
62 0.08
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.05
69 0.05
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.09
76 0.1
77 0.1
78 0.12
79 0.12
80 0.14
81 0.14
82 0.17
83 0.15
84 0.15
85 0.15
86 0.14
87 0.14
88 0.13
89 0.12
90 0.11
91 0.09
92 0.08
93 0.07
94 0.07
95 0.07
96 0.09
97 0.08
98 0.07
99 0.08
100 0.12
101 0.12
102 0.13
103 0.14