Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HN88

Protein Details
Accession A0A395HN88    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
136-155VTPSQLKMWHRHHRGPRSRMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, cysk 6, cyto_nucl 5.5, nucl 5, pero 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011006  CheY-like_superfamily  
IPR001789  Sig_transdc_resp-reg_receiver  
Gene Ontology GO:0000160  P:phosphorelay signal transduction system  
Pfam View protein in Pfam  
PF00072  Response_reg  
PROSITE View protein in PROSITE  
PS50110  RESPONSE_REGULATORY  
CDD cd17546  REC_hyHK_CKI1_RcsC-like  
Amino Acid Sequences MQLLLVHDNLVTQKLFQRIGGRLECDVHVIGSGPAVLDYLAMAPTRPDIIFMKTSLPGISGYEVVRMIRTQPPFCNDPQLQMTPIIGLTASTVGTNLSRERASGYNDFLRSPLRINDVAKTIAHWSRRQIMGPTEVTPSQLKMWHRHHRGPRSRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.27
5 0.28
6 0.35
7 0.37
8 0.34
9 0.31
10 0.33
11 0.3
12 0.27
13 0.23
14 0.17
15 0.13
16 0.12
17 0.1
18 0.08
19 0.08
20 0.05
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.08
33 0.08
34 0.1
35 0.1
36 0.14
37 0.15
38 0.16
39 0.17
40 0.16
41 0.17
42 0.14
43 0.14
44 0.11
45 0.1
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.08
54 0.1
55 0.13
56 0.16
57 0.18
58 0.19
59 0.23
60 0.24
61 0.25
62 0.3
63 0.25
64 0.25
65 0.26
66 0.25
67 0.22
68 0.2
69 0.2
70 0.12
71 0.12
72 0.09
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.06
83 0.07
84 0.08
85 0.08
86 0.09
87 0.12
88 0.14
89 0.18
90 0.19
91 0.22
92 0.25
93 0.26
94 0.26
95 0.24
96 0.23
97 0.2
98 0.2
99 0.19
100 0.18
101 0.21
102 0.22
103 0.24
104 0.25
105 0.26
106 0.23
107 0.22
108 0.23
109 0.24
110 0.27
111 0.27
112 0.29
113 0.35
114 0.37
115 0.38
116 0.37
117 0.37
118 0.38
119 0.38
120 0.35
121 0.32
122 0.3
123 0.3
124 0.27
125 0.25
126 0.22
127 0.24
128 0.27
129 0.32
130 0.42
131 0.5
132 0.57
133 0.65
134 0.73
135 0.79