Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D6RL93

Protein Details
Accession D6RL93    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-100QKGVEYQPSQRKRKRRHGFLARKKTAAHydrophilic
NLS Segment(s)
PositionSequence
84-114RKRKRRHGFLARKKTAAGRRVLANRLAKGRR
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cci:CC1G_14228  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLLQFLARLPRLVTDVVPRAVSSRPTQQWPLSSLRSTFHRPSLTSSSFLPQPAFSLSRSPVLGALMQARSVQKGVEYQPSQRKRKRRHGFLARKKTAAGRRVLANRLAKGRRYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.22
3 0.21
4 0.24
5 0.25
6 0.25
7 0.23
8 0.22
9 0.23
10 0.25
11 0.22
12 0.26
13 0.29
14 0.33
15 0.37
16 0.38
17 0.39
18 0.4
19 0.41
20 0.36
21 0.34
22 0.3
23 0.28
24 0.3
25 0.33
26 0.32
27 0.32
28 0.31
29 0.3
30 0.35
31 0.4
32 0.37
33 0.32
34 0.31
35 0.27
36 0.26
37 0.26
38 0.21
39 0.13
40 0.13
41 0.13
42 0.14
43 0.12
44 0.13
45 0.13
46 0.14
47 0.14
48 0.13
49 0.11
50 0.11
51 0.11
52 0.09
53 0.1
54 0.08
55 0.09
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.07
62 0.1
63 0.12
64 0.19
65 0.21
66 0.27
67 0.37
68 0.46
69 0.55
70 0.59
71 0.67
72 0.69
73 0.79
74 0.83
75 0.83
76 0.85
77 0.87
78 0.92
79 0.93
80 0.94
81 0.88
82 0.78
83 0.69
84 0.67
85 0.63
86 0.58
87 0.53
88 0.45
89 0.48
90 0.53
91 0.55
92 0.54
93 0.52
94 0.51
95 0.54
96 0.55
97 0.51
98 0.52