Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395I834

Protein Details
Accession A0A395I834   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SGASTSQGGWRRRRRRPGPPSMLSHVHydrophilic
NLS Segment(s)
PositionSequence
12-19RRRRRRPG
Subcellular Location(s) plas 12, mito 10, nucl 1, extr 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGASTSQGGWRRRRRRPGPPSMLSHVMITNQPLSSNAPNRCVRSQGASLPKTEFFLVFFFLLCFCLRLIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.84
4 0.88
5 0.89
6 0.88
7 0.84
8 0.8
9 0.75
10 0.69
11 0.59
12 0.49
13 0.38
14 0.29
15 0.24
16 0.18
17 0.14
18 0.1
19 0.09
20 0.09
21 0.12
22 0.14
23 0.2
24 0.21
25 0.26
26 0.29
27 0.33
28 0.33
29 0.33
30 0.31
31 0.29
32 0.3
33 0.3
34 0.36
35 0.33
36 0.34
37 0.34
38 0.33
39 0.3
40 0.28
41 0.22
42 0.14
43 0.14
44 0.15
45 0.12
46 0.12
47 0.11
48 0.1
49 0.12
50 0.11
51 0.1