Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HL91

Protein Details
Accession A0A395HL91    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-36ERGLPFLGPLRRRRRRRRRRTFGMRASSAFBasic
NLS Segment(s)
PositionSequence
15-27PLRRRRRRRRRRT
Subcellular Location(s) plas 18, nucl 3, E.R. 3, mito 1, cyto 1, vacu 1, cyto_mito 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTPSAHERGLPFLGPLRRRRRRRRRRTFGMRASSAFSSREELPGPDQFILVFCRGVLVLLIRRGRLVFCRAGLVVVLCIEVLVLVLCRGDGES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.43
3 0.49
4 0.57
5 0.68
6 0.78
7 0.83
8 0.88
9 0.93
10 0.95
11 0.94
12 0.95
13 0.96
14 0.95
15 0.94
16 0.91
17 0.82
18 0.72
19 0.64
20 0.54
21 0.44
22 0.34
23 0.25
24 0.2
25 0.17
26 0.17
27 0.14
28 0.14
29 0.15
30 0.16
31 0.17
32 0.13
33 0.13
34 0.11
35 0.11
36 0.12
37 0.1
38 0.08
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.08
46 0.13
47 0.14
48 0.14
49 0.15
50 0.15
51 0.16
52 0.18
53 0.2
54 0.18
55 0.17
56 0.2
57 0.19
58 0.19
59 0.18
60 0.15
61 0.11
62 0.09
63 0.08
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04