Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HSI4

Protein Details
Accession A0A395HSI4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-113QSDSNSKPKKDPQQRKRRSRPPKLRQQEEGGHydrophilic
NLS Segment(s)
PositionSequence
89-107KPKKDPQQRKRRSRPPKLR
Subcellular Location(s) nucl 21, cyto_nucl 12.833, cyto 2.5, cyto_pero 2.166
Family & Domain DBs
Amino Acid Sequences MSEQTNNPSSNPSTPQQENTPGSPQPKEEEQSEQQQQQEDQPEVKQEEDEEEEEEEEDKKQEDPQPKQEEPESDGPQPKQEPQSDSNSKPKKDPQQRKRRSRPPKLRQQEEGGDGKDEQLRLRLDLNLDIEVQLKAKIHGDLTLGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.41
4 0.47
5 0.45
6 0.44
7 0.45
8 0.42
9 0.43
10 0.4
11 0.37
12 0.33
13 0.35
14 0.34
15 0.32
16 0.35
17 0.35
18 0.41
19 0.45
20 0.43
21 0.4
22 0.4
23 0.38
24 0.35
25 0.36
26 0.29
27 0.25
28 0.23
29 0.26
30 0.24
31 0.24
32 0.19
33 0.15
34 0.16
35 0.17
36 0.17
37 0.14
38 0.13
39 0.13
40 0.13
41 0.13
42 0.11
43 0.08
44 0.08
45 0.08
46 0.08
47 0.11
48 0.16
49 0.24
50 0.28
51 0.37
52 0.45
53 0.44
54 0.46
55 0.44
56 0.41
57 0.37
58 0.38
59 0.32
60 0.27
61 0.3
62 0.28
63 0.29
64 0.28
65 0.27
66 0.25
67 0.25
68 0.26
69 0.27
70 0.35
71 0.38
72 0.41
73 0.48
74 0.5
75 0.48
76 0.48
77 0.52
78 0.54
79 0.6
80 0.67
81 0.68
82 0.73
83 0.83
84 0.9
85 0.93
86 0.93
87 0.93
88 0.94
89 0.94
90 0.93
91 0.94
92 0.93
93 0.89
94 0.83
95 0.79
96 0.72
97 0.66
98 0.6
99 0.5
100 0.41
101 0.34
102 0.31
103 0.27
104 0.22
105 0.18
106 0.18
107 0.18
108 0.18
109 0.2
110 0.2
111 0.19
112 0.22
113 0.23
114 0.19
115 0.19
116 0.17
117 0.17
118 0.15
119 0.14
120 0.13
121 0.12
122 0.12
123 0.14
124 0.15
125 0.14
126 0.16
127 0.17