Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HK31

Protein Details
Accession A0A395HK31   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
146-165APQNEKKEKRTAKHDPWAKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007763  NDUFA12  
Gene Ontology GO:0016020  C:membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
Pfam View protein in Pfam  
PF05071  NDUFA12  
Amino Acid Sequences MSPINSLWFKWKSLKLPWRTSYLVGHDLKGNTYWEFKDALNANRYRRIVKCDPKTHLSDVEVSPQWHQWLRYVRADPPSIQEQQQDILRQIQIKELARLADERWASKPSYLDKPQTQQPAPATQTSDATMNPPKIEKQTSKADPPAPQNEKKEKRTAKHDPWAKAASGPGENWQPDSWNPTSSQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.69
4 0.69
5 0.67
6 0.64
7 0.6
8 0.55
9 0.51
10 0.5
11 0.41
12 0.39
13 0.37
14 0.34
15 0.33
16 0.29
17 0.26
18 0.19
19 0.21
20 0.2
21 0.17
22 0.19
23 0.17
24 0.22
25 0.25
26 0.29
27 0.33
28 0.37
29 0.39
30 0.44
31 0.46
32 0.44
33 0.42
34 0.46
35 0.48
36 0.53
37 0.6
38 0.61
39 0.64
40 0.65
41 0.66
42 0.61
43 0.54
44 0.45
45 0.39
46 0.32
47 0.32
48 0.29
49 0.25
50 0.23
51 0.21
52 0.22
53 0.2
54 0.19
55 0.19
56 0.25
57 0.29
58 0.34
59 0.35
60 0.36
61 0.38
62 0.39
63 0.34
64 0.3
65 0.3
66 0.26
67 0.25
68 0.23
69 0.19
70 0.2
71 0.21
72 0.18
73 0.15
74 0.15
75 0.15
76 0.15
77 0.15
78 0.15
79 0.17
80 0.17
81 0.17
82 0.15
83 0.15
84 0.13
85 0.14
86 0.12
87 0.13
88 0.13
89 0.13
90 0.14
91 0.16
92 0.16
93 0.17
94 0.19
95 0.18
96 0.26
97 0.29
98 0.33
99 0.34
100 0.38
101 0.42
102 0.47
103 0.43
104 0.39
105 0.37
106 0.38
107 0.37
108 0.35
109 0.31
110 0.25
111 0.25
112 0.22
113 0.21
114 0.14
115 0.16
116 0.18
117 0.17
118 0.18
119 0.18
120 0.19
121 0.23
122 0.29
123 0.29
124 0.3
125 0.38
126 0.42
127 0.47
128 0.5
129 0.5
130 0.49
131 0.53
132 0.58
133 0.55
134 0.57
135 0.6
136 0.65
137 0.7
138 0.7
139 0.74
140 0.72
141 0.72
142 0.75
143 0.77
144 0.76
145 0.78
146 0.8
147 0.74
148 0.72
149 0.69
150 0.59
151 0.51
152 0.43
153 0.37
154 0.31
155 0.28
156 0.25
157 0.28
158 0.28
159 0.29
160 0.27
161 0.26
162 0.25
163 0.31
164 0.28
165 0.25