Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395I7N3

Protein Details
Accession A0A395I7N3   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
125-145VTPKPKRVRKTPTKKAATPKVHydrophilic
NLS Segment(s)
PositionSequence
128-141KPKRVRKTPTKKAA
Subcellular Location(s) cyto 21, nucl 3.5, mito_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MAAKGAPKPEGLFGLTLSEAKMIILGQICTDSSGKVDHDKLAIKGGYKNGASAYTVYRNAKRKLEELQFEESGTVNGGASSAATTPLKTPTRRKRAKAVDATPDDTPATPATPSGPGPVQADVAVTPKPKRVRKTPTKKAATPKVVPKAEELDSDGGSTMKLDSSPVVEPTTDKENHAVLKGLKRELSVEPDHNEENLTSHGRVPKKHLTASDEEVAMAVLDVGAEMDALDTAQVPVKTEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.14
5 0.12
6 0.1
7 0.09
8 0.09
9 0.06
10 0.08
11 0.1
12 0.1
13 0.09
14 0.11
15 0.11
16 0.12
17 0.13
18 0.11
19 0.1
20 0.12
21 0.13
22 0.17
23 0.19
24 0.19
25 0.22
26 0.25
27 0.24
28 0.28
29 0.28
30 0.25
31 0.27
32 0.28
33 0.3
34 0.27
35 0.27
36 0.22
37 0.21
38 0.2
39 0.18
40 0.19
41 0.19
42 0.23
43 0.27
44 0.32
45 0.39
46 0.43
47 0.47
48 0.46
49 0.44
50 0.48
51 0.52
52 0.51
53 0.47
54 0.48
55 0.43
56 0.4
57 0.37
58 0.29
59 0.21
60 0.16
61 0.12
62 0.06
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.06
70 0.06
71 0.07
72 0.08
73 0.15
74 0.2
75 0.24
76 0.34
77 0.43
78 0.54
79 0.61
80 0.64
81 0.68
82 0.73
83 0.78
84 0.77
85 0.71
86 0.69
87 0.64
88 0.63
89 0.52
90 0.44
91 0.34
92 0.25
93 0.21
94 0.12
95 0.1
96 0.07
97 0.07
98 0.08
99 0.09
100 0.09
101 0.09
102 0.09
103 0.1
104 0.11
105 0.11
106 0.1
107 0.09
108 0.09
109 0.07
110 0.09
111 0.09
112 0.09
113 0.1
114 0.15
115 0.22
116 0.27
117 0.32
118 0.4
119 0.49
120 0.59
121 0.7
122 0.75
123 0.78
124 0.8
125 0.8
126 0.8
127 0.79
128 0.75
129 0.69
130 0.67
131 0.65
132 0.6
133 0.55
134 0.47
135 0.42
136 0.36
137 0.31
138 0.26
139 0.18
140 0.17
141 0.16
142 0.14
143 0.1
144 0.09
145 0.08
146 0.06
147 0.05
148 0.05
149 0.05
150 0.05
151 0.08
152 0.09
153 0.1
154 0.11
155 0.11
156 0.11
157 0.14
158 0.2
159 0.18
160 0.18
161 0.19
162 0.2
163 0.21
164 0.22
165 0.22
166 0.19
167 0.25
168 0.28
169 0.29
170 0.28
171 0.27
172 0.29
173 0.28
174 0.31
175 0.29
176 0.29
177 0.29
178 0.31
179 0.31
180 0.29
181 0.27
182 0.21
183 0.18
184 0.17
185 0.18
186 0.15
187 0.19
188 0.25
189 0.28
190 0.31
191 0.36
192 0.43
193 0.45
194 0.49
195 0.5
196 0.49
197 0.51
198 0.54
199 0.5
200 0.41
201 0.35
202 0.3
203 0.26
204 0.19
205 0.13
206 0.07
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.04
218 0.04
219 0.05
220 0.1
221 0.1