Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395I2H0

Protein Details
Accession A0A395I2H0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
82-111ASILRPRPGPRPRPRPDPYRKSRVRCGAITHydrophilic
NLS Segment(s)
PositionSequence
86-103RPRPGPRPRPRPDPYRKS
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MAHPQANLSPVTTGRGETQRKERGKGNCKREGRDVIHVGCNAHDVSASSFPSAVSLSSFHLVPGRRPSGSVFLLYSSSVTSASILRPRPGPRPRPRPDPYRKSRVRCGAIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.27
3 0.31
4 0.34
5 0.43
6 0.49
7 0.52
8 0.55
9 0.57
10 0.59
11 0.65
12 0.69
13 0.68
14 0.68
15 0.7
16 0.7
17 0.71
18 0.69
19 0.62
20 0.61
21 0.57
22 0.5
23 0.48
24 0.45
25 0.38
26 0.29
27 0.26
28 0.18
29 0.13
30 0.11
31 0.07
32 0.09
33 0.11
34 0.11
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.07
41 0.05
42 0.06
43 0.07
44 0.07
45 0.08
46 0.07
47 0.1
48 0.11
49 0.13
50 0.18
51 0.2
52 0.19
53 0.2
54 0.22
55 0.24
56 0.24
57 0.23
58 0.17
59 0.15
60 0.16
61 0.15
62 0.13
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.1
70 0.15
71 0.17
72 0.19
73 0.24
74 0.28
75 0.37
76 0.46
77 0.53
78 0.59
79 0.68
80 0.73
81 0.78
82 0.82
83 0.83
84 0.84
85 0.85
86 0.83
87 0.84
88 0.86
89 0.83
90 0.87
91 0.86