Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HYH6

Protein Details
Accession A0A395HYH6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-96GSGSRSRWKSRRSKTTRRSPNPKCERKSDHydrophilic
NLS Segment(s)
PositionSequence
70-87GSRSRWKSRRSKTTRRSP
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDTTAETSLTCHELSNSISQACDTGNSPACSCFETDSHSPLSISLPASPPSPVKVVSGPKLPKPEVMGSGSRSRWKSRRSKTTRRSPNPKCERKSDITIDSSKPFKLSNLSTPELEKSFRALSCHHLKLQEKHVALMKAHLERENEITRLTAQIRALENELYLTQLAHSDEAFDPLRTSLNQYDIRPTGDTPSREAHTTLPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.21
4 0.19
5 0.19
6 0.18
7 0.18
8 0.16
9 0.15
10 0.12
11 0.15
12 0.21
13 0.22
14 0.23
15 0.24
16 0.24
17 0.24
18 0.23
19 0.2
20 0.14
21 0.19
22 0.21
23 0.22
24 0.24
25 0.23
26 0.22
27 0.2
28 0.21
29 0.17
30 0.16
31 0.15
32 0.15
33 0.16
34 0.17
35 0.18
36 0.17
37 0.17
38 0.17
39 0.16
40 0.15
41 0.2
42 0.24
43 0.26
44 0.33
45 0.34
46 0.36
47 0.42
48 0.4
49 0.37
50 0.36
51 0.35
52 0.3
53 0.31
54 0.29
55 0.26
56 0.31
57 0.31
58 0.32
59 0.32
60 0.35
61 0.38
62 0.45
63 0.52
64 0.56
65 0.66
66 0.7
67 0.79
68 0.82
69 0.87
70 0.89
71 0.88
72 0.9
73 0.87
74 0.88
75 0.88
76 0.87
77 0.8
78 0.75
79 0.72
80 0.66
81 0.63
82 0.57
83 0.49
84 0.43
85 0.42
86 0.38
87 0.34
88 0.3
89 0.24
90 0.21
91 0.17
92 0.14
93 0.15
94 0.16
95 0.2
96 0.24
97 0.26
98 0.26
99 0.26
100 0.27
101 0.25
102 0.23
103 0.17
104 0.13
105 0.14
106 0.14
107 0.15
108 0.15
109 0.21
110 0.27
111 0.3
112 0.29
113 0.32
114 0.36
115 0.39
116 0.45
117 0.45
118 0.38
119 0.37
120 0.39
121 0.36
122 0.32
123 0.31
124 0.28
125 0.24
126 0.25
127 0.26
128 0.23
129 0.23
130 0.28
131 0.28
132 0.24
133 0.21
134 0.2
135 0.18
136 0.2
137 0.19
138 0.17
139 0.15
140 0.19
141 0.21
142 0.21
143 0.23
144 0.2
145 0.18
146 0.16
147 0.16
148 0.12
149 0.1
150 0.08
151 0.07
152 0.09
153 0.1
154 0.09
155 0.09
156 0.11
157 0.11
158 0.16
159 0.17
160 0.15
161 0.15
162 0.15
163 0.18
164 0.15
165 0.2
166 0.19
167 0.25
168 0.3
169 0.3
170 0.37
171 0.37
172 0.39
173 0.36
174 0.34
175 0.33
176 0.35
177 0.36
178 0.32
179 0.36
180 0.36
181 0.36
182 0.37