Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HFH4

Protein Details
Accession A0A395HFH4   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-26ETTTETVRSLKRKRSERKNQEFFLDHydrophilic
60-85VKGERLSLKKRTKDKQRLYRDFLVKCHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, nucl 9.5, cyto_nucl 6, mito 3, cyto 1.5
Family & Domain DBs
Amino Acid Sequences METTTETVRSLKRKRSERKNQEFFLDASVRKIEDYAERIDRKAAPTTSDKNRLISDVKLVKGERLSLKKRTKDKQRLYRDFLVKCIRCTELGPNVMVLCSLALGLTGIYGLNQLGMEGFFQRLVSRGSWESPAVTEIARSYDVPDATFPGLGSEPLADLDFECMGVRYSETFPLDSAISKFLPVEISPAVLPIDQVSATFNVKLDMPFQPTSSASLTLRFEIDRELAWQIVPFYQPDSAVIASEGAQTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.86
4 0.88
5 0.91
6 0.91
7 0.85
8 0.79
9 0.72
10 0.61
11 0.56
12 0.5
13 0.39
14 0.33
15 0.31
16 0.27
17 0.24
18 0.23
19 0.18
20 0.18
21 0.21
22 0.23
23 0.3
24 0.32
25 0.32
26 0.36
27 0.36
28 0.34
29 0.38
30 0.33
31 0.29
32 0.34
33 0.41
34 0.46
35 0.52
36 0.51
37 0.47
38 0.47
39 0.46
40 0.41
41 0.35
42 0.35
43 0.31
44 0.31
45 0.32
46 0.31
47 0.3
48 0.29
49 0.32
50 0.31
51 0.34
52 0.39
53 0.44
54 0.53
55 0.58
56 0.66
57 0.71
58 0.75
59 0.78
60 0.83
61 0.84
62 0.86
63 0.87
64 0.86
65 0.85
66 0.81
67 0.71
68 0.67
69 0.66
70 0.56
71 0.49
72 0.44
73 0.36
74 0.29
75 0.3
76 0.29
77 0.25
78 0.25
79 0.24
80 0.22
81 0.21
82 0.19
83 0.18
84 0.12
85 0.05
86 0.04
87 0.03
88 0.03
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.06
110 0.07
111 0.07
112 0.09
113 0.1
114 0.11
115 0.12
116 0.13
117 0.12
118 0.1
119 0.11
120 0.09
121 0.08
122 0.07
123 0.06
124 0.07
125 0.08
126 0.07
127 0.08
128 0.11
129 0.11
130 0.11
131 0.11
132 0.12
133 0.11
134 0.11
135 0.09
136 0.08
137 0.08
138 0.08
139 0.08
140 0.06
141 0.06
142 0.06
143 0.06
144 0.05
145 0.05
146 0.06
147 0.06
148 0.06
149 0.06
150 0.05
151 0.06
152 0.06
153 0.06
154 0.07
155 0.09
156 0.12
157 0.13
158 0.13
159 0.13
160 0.14
161 0.14
162 0.13
163 0.13
164 0.12
165 0.11
166 0.11
167 0.11
168 0.1
169 0.11
170 0.1
171 0.12
172 0.09
173 0.11
174 0.1
175 0.11
176 0.11
177 0.09
178 0.09
179 0.07
180 0.08
181 0.07
182 0.07
183 0.08
184 0.09
185 0.11
186 0.11
187 0.11
188 0.1
189 0.11
190 0.12
191 0.13
192 0.15
193 0.19
194 0.2
195 0.2
196 0.22
197 0.22
198 0.25
199 0.24
200 0.24
201 0.18
202 0.22
203 0.23
204 0.22
205 0.23
206 0.2
207 0.18
208 0.18
209 0.19
210 0.15
211 0.15
212 0.16
213 0.15
214 0.15
215 0.15
216 0.14
217 0.15
218 0.15
219 0.13
220 0.14
221 0.15
222 0.15
223 0.15
224 0.17
225 0.15
226 0.15
227 0.14
228 0.13
229 0.12