Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HT72

Protein Details
Accession A0A395HT72   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
471-495ISLFYPRKSKAHKPKSPTPSTKSSAHydrophilic
505-528AEGDSEPPTKRRRRSPRHANATSPHydrophilic
NLS Segment(s)
PositionSequence
514-521KRRRRSPR
Subcellular Location(s) plas 18, E.R. 3, vacu 3, mito 1, pero 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007369  Peptidase_A22B_SPP  
IPR006639  Preselin/SPP  
Gene Ontology GO:0016020  C:membrane  
GO:0004190  F:aspartic-type endopeptidase activity  
Pfam View protein in Pfam  
PF04258  Peptidase_A22B  
Amino Acid Sequences MFPLTAGLTLGGLYLFIKYKGAETLNKILGYYFSQMGLLFAIAFLKDFLSVVRSFLFPKRYSYSGRIWKQKPSEQAFTGAKGDQDSSEPVEVRRSPLPGILSRIPLPNATRTAIWKLRSVLYWRAKLRVHVRRVVRGETWLDMLDVLSTFLALPAIGYFTFVTKPWWLTNFLGFSFCYGTLQFMSPSTFVTGSLILGSLFFYDIYFVYFTPLMVTVAKKLDVPIKLLFPRPPVSGEATDTVSLAMLGLGDIIIPGMMVGLALRFDLYLYYKRKGLQKARAEGNGVEFIKPVYQTVTGGWGERFWTRSVAPKEPELQPPYHDAQSFPKTYFKASIVGYLVGMVATLVVMQIFDHPQPALLYLVPGVLISLWGTALVRNEIGEMWEYSEGEEDEEEEKGDEKEEDKKEQTEKQENLGFFARVLSFCKQADNNPGETSEEKDKKAADDEDEKKSNASSGNVEDREVKDCELFTISLFYPRKSKAHKPKSPTPSTKSSADEENWSVVGAEGDSEPPTKRRRRSPRHANATSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.1
6 0.12
7 0.17
8 0.21
9 0.25
10 0.3
11 0.37
12 0.41
13 0.41
14 0.39
15 0.34
16 0.32
17 0.3
18 0.27
19 0.2
20 0.15
21 0.16
22 0.16
23 0.16
24 0.14
25 0.11
26 0.07
27 0.06
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.1
37 0.1
38 0.12
39 0.13
40 0.14
41 0.17
42 0.22
43 0.3
44 0.27
45 0.33
46 0.37
47 0.39
48 0.44
49 0.46
50 0.51
51 0.54
52 0.61
53 0.65
54 0.64
55 0.69
56 0.71
57 0.72
58 0.72
59 0.69
60 0.67
61 0.58
62 0.63
63 0.56
64 0.5
65 0.46
66 0.37
67 0.31
68 0.25
69 0.24
70 0.17
71 0.17
72 0.17
73 0.17
74 0.19
75 0.19
76 0.18
77 0.24
78 0.24
79 0.26
80 0.27
81 0.26
82 0.24
83 0.26
84 0.3
85 0.26
86 0.32
87 0.31
88 0.31
89 0.31
90 0.33
91 0.31
92 0.3
93 0.3
94 0.28
95 0.28
96 0.26
97 0.25
98 0.26
99 0.33
100 0.35
101 0.35
102 0.34
103 0.34
104 0.34
105 0.36
106 0.38
107 0.4
108 0.42
109 0.48
110 0.46
111 0.49
112 0.48
113 0.52
114 0.57
115 0.57
116 0.55
117 0.55
118 0.57
119 0.6
120 0.63
121 0.6
122 0.51
123 0.45
124 0.41
125 0.35
126 0.32
127 0.23
128 0.19
129 0.15
130 0.14
131 0.1
132 0.08
133 0.07
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.03
142 0.05
143 0.05
144 0.06
145 0.06
146 0.07
147 0.08
148 0.09
149 0.11
150 0.12
151 0.14
152 0.15
153 0.17
154 0.2
155 0.21
156 0.24
157 0.24
158 0.22
159 0.21
160 0.19
161 0.18
162 0.16
163 0.15
164 0.12
165 0.1
166 0.11
167 0.1
168 0.11
169 0.1
170 0.09
171 0.11
172 0.1
173 0.11
174 0.11
175 0.1
176 0.09
177 0.1
178 0.09
179 0.08
180 0.08
181 0.07
182 0.05
183 0.05
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.06
192 0.06
193 0.06
194 0.08
195 0.08
196 0.08
197 0.08
198 0.08
199 0.08
200 0.08
201 0.09
202 0.09
203 0.1
204 0.11
205 0.1
206 0.11
207 0.15
208 0.15
209 0.18
210 0.17
211 0.2
212 0.22
213 0.24
214 0.25
215 0.24
216 0.25
217 0.23
218 0.23
219 0.21
220 0.23
221 0.21
222 0.21
223 0.19
224 0.17
225 0.16
226 0.15
227 0.13
228 0.09
229 0.08
230 0.06
231 0.04
232 0.03
233 0.02
234 0.02
235 0.02
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.01
242 0.01
243 0.01
244 0.01
245 0.02
246 0.02
247 0.02
248 0.02
249 0.02
250 0.02
251 0.02
252 0.03
253 0.05
254 0.12
255 0.15
256 0.16
257 0.18
258 0.22
259 0.28
260 0.36
261 0.42
262 0.45
263 0.49
264 0.55
265 0.56
266 0.55
267 0.5
268 0.43
269 0.37
270 0.32
271 0.25
272 0.19
273 0.15
274 0.14
275 0.13
276 0.13
277 0.11
278 0.07
279 0.07
280 0.07
281 0.08
282 0.12
283 0.11
284 0.12
285 0.12
286 0.1
287 0.11
288 0.12
289 0.13
290 0.1
291 0.12
292 0.12
293 0.2
294 0.24
295 0.29
296 0.29
297 0.3
298 0.34
299 0.35
300 0.41
301 0.36
302 0.32
303 0.28
304 0.31
305 0.31
306 0.3
307 0.27
308 0.22
309 0.25
310 0.3
311 0.3
312 0.26
313 0.28
314 0.26
315 0.27
316 0.29
317 0.23
318 0.22
319 0.2
320 0.23
321 0.19
322 0.19
323 0.17
324 0.14
325 0.13
326 0.08
327 0.08
328 0.04
329 0.03
330 0.02
331 0.02
332 0.02
333 0.02
334 0.02
335 0.02
336 0.04
337 0.06
338 0.06
339 0.07
340 0.07
341 0.08
342 0.08
343 0.09
344 0.09
345 0.07
346 0.08
347 0.07
348 0.07
349 0.06
350 0.06
351 0.05
352 0.03
353 0.04
354 0.03
355 0.03
356 0.03
357 0.03
358 0.04
359 0.05
360 0.06
361 0.07
362 0.07
363 0.07
364 0.08
365 0.08
366 0.08
367 0.09
368 0.08
369 0.09
370 0.1
371 0.1
372 0.09
373 0.11
374 0.1
375 0.09
376 0.09
377 0.08
378 0.09
379 0.09
380 0.09
381 0.08
382 0.09
383 0.09
384 0.1
385 0.09
386 0.1
387 0.19
388 0.22
389 0.27
390 0.29
391 0.34
392 0.38
393 0.43
394 0.5
395 0.51
396 0.49
397 0.5
398 0.53
399 0.48
400 0.47
401 0.43
402 0.34
403 0.25
404 0.25
405 0.2
406 0.15
407 0.19
408 0.18
409 0.19
410 0.19
411 0.24
412 0.23
413 0.26
414 0.35
415 0.35
416 0.35
417 0.32
418 0.33
419 0.31
420 0.31
421 0.31
422 0.32
423 0.32
424 0.31
425 0.32
426 0.33
427 0.32
428 0.36
429 0.35
430 0.3
431 0.35
432 0.39
433 0.45
434 0.47
435 0.45
436 0.4
437 0.38
438 0.35
439 0.28
440 0.25
441 0.21
442 0.23
443 0.32
444 0.32
445 0.33
446 0.35
447 0.34
448 0.35
449 0.33
450 0.29
451 0.22
452 0.21
453 0.22
454 0.2
455 0.18
456 0.15
457 0.18
458 0.17
459 0.24
460 0.26
461 0.26
462 0.29
463 0.33
464 0.41
465 0.44
466 0.55
467 0.57
468 0.67
469 0.74
470 0.76
471 0.82
472 0.85
473 0.88
474 0.87
475 0.82
476 0.8
477 0.76
478 0.73
479 0.66
480 0.59
481 0.55
482 0.48
483 0.47
484 0.4
485 0.37
486 0.32
487 0.28
488 0.25
489 0.18
490 0.16
491 0.1
492 0.09
493 0.08
494 0.09
495 0.1
496 0.12
497 0.14
498 0.2
499 0.3
500 0.38
501 0.46
502 0.56
503 0.66
504 0.75
505 0.84
506 0.89
507 0.91
508 0.93