FuNGI

A0A395HT72

Protein Details

Accession

A0A395HT72

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
471-495	ISLFYPRKSKAHKPKSPTPSTKSSA	Hydrophilic
505-528	AEGDSEPPTKRRRRSPRHANATSP	Hydrophilic

NLS Segment(s)

Position	Sequence
514-521	KRRRRSPR

Subcellular Location(s)

plas 18, E.R. 3, vacu 3, mito 1, pero 1, golg 1

Family & Domain DBs

InterPro	View protein in InterPro IPR007369 Peptidase_A22B_SPP IPR006639 Preselin/SPP
Gene Ontology	GO:0016020 C:membrane GO:0004190 F:aspartic-type endopeptidase activity
Pfam	View protein in Pfam PF04258 Peptidase_A22B

Amino Acid Sequences

MFPLTAGLTLGGLYLFIKYKGAETLNKILGYYFSQMGLLFAIAFLKDFLSVVRSFLFPKRYSYSGRIWKQKPSEQAFTGAKGDQDSSEPVEVRRSPLPGILSRIPLPNATRTAIWKLRSVLYWRAKLRVHVRRVVRGETWLDMLDVLSTFLALPAIGYFTFVTKPWWLTNFLGFSFCYGTLQFMSPSTFVTGSLILGSLFFYDIYFVYFTPLMVTVAKKLDVPIKLLFPRPPVSGEATDTVSLAMLGLGDIIIPGMMVGLALRFDLYLYYKRKGLQKARAEGNGVEFIKPVYQTVTGGWGERFWTRSVAPKEPELQPPYHDAQSFPKTYFKASIVGYLVGMVATLVVMQIFDHPQPALLYLVPGVLISLWGTALVRNEIGEMWEYSEGEEDEEEEKGDEKEEDKKEQTEKQENLGFFARVLSFCKQADNNPGETSEEKDKKAADDEDEKKSNASSGNVEDREVKDCELFTISLFYPRKSKAHKPKSPTPSTKSSADEENWSVVGAEGDSEPPTKRRRRSPRHANATSP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.07
2	0.08
3	0.09
4	0.1
5	0.1
6	0.12
7	0.17
8	0.21
9	0.25
10	0.3
11	0.37
12	0.41
13	0.41
14	0.39
15	0.34
16	0.32
17	0.3
18	0.27
19	0.2
20	0.15
21	0.16
22	0.16
23	0.16
24	0.14
25	0.11
26	0.07
27	0.06
28	0.07
29	0.06
30	0.06
31	0.06
32	0.06
33	0.06
34	0.06
35	0.07
36	0.1
37	0.1
38	0.12
39	0.13
40	0.14
41	0.17
42	0.22
43	0.3
44	0.27
45	0.33
46	0.37
47	0.39
48	0.44
49	0.46
50	0.51
51	0.54
52	0.61
53	0.65
54	0.64
55	0.69
56	0.71
57	0.72
58	0.72
59	0.69
60	0.67
61	0.58
62	0.63
63	0.56
64	0.5
65	0.46
66	0.37
67	0.31
68	0.25
69	0.24
70	0.17
71	0.17
72	0.17
73	0.17
74	0.19
75	0.19
76	0.18
77	0.24
78	0.24
79	0.26
80	0.27
81	0.26
82	0.24
83	0.26
84	0.3
85	0.26
86	0.32
87	0.31
88	0.31
89	0.31
90	0.33
91	0.31
92	0.3
93	0.3
94	0.28
95	0.28
96	0.26
97	0.25
98	0.26
99	0.33
100	0.35
101	0.35
102	0.34
103	0.34
104	0.34
105	0.36
106	0.38
107	0.4
108	0.42
109	0.48
110	0.46
111	0.49
112	0.48
113	0.52
114	0.57
115	0.57
116	0.55
117	0.55
118	0.57
119	0.6
120	0.63
121	0.6
122	0.51
123	0.45
124	0.41
125	0.35
126	0.32
127	0.23
128	0.19
129	0.15
130	0.14
131	0.1
132	0.08
133	0.07
134	0.05
135	0.05
136	0.04
137	0.04
138	0.04
139	0.04
140	0.04
141	0.03
142	0.05
143	0.05
144	0.06
145	0.06
146	0.07
147	0.08
148	0.09
149	0.11
150	0.12
151	0.14
152	0.15
153	0.17
154	0.2
155	0.21
156	0.24
157	0.24
158	0.22
159	0.21
160	0.19
161	0.18
162	0.16
163	0.15
164	0.12
165	0.1
166	0.11
167	0.1
168	0.11
169	0.1
170	0.09
171	0.11
172	0.1
173	0.11
174	0.11
175	0.1
176	0.09
177	0.1
178	0.09
179	0.08
180	0.08
181	0.07
182	0.05
183	0.05
184	0.05
185	0.04
186	0.04
187	0.04
188	0.04
189	0.04
190	0.05
191	0.06
192	0.06
193	0.06
194	0.08
195	0.08
196	0.08
197	0.08
198	0.08
199	0.08
200	0.08
201	0.09
202	0.09
203	0.1
204	0.11
205	0.1
206	0.11
207	0.15
208	0.15
209	0.18
210	0.17
211	0.2
212	0.22
213	0.24
214	0.25
215	0.24
216	0.25
217	0.23
218	0.23
219	0.21
220	0.23
221	0.21
222	0.21
223	0.19
224	0.17
225	0.16
226	0.15
227	0.13
228	0.09
229	0.08
230	0.06
231	0.04
232	0.03
233	0.02
234	0.02
235	0.02
236	0.02
237	0.02
238	0.02
239	0.02
240	0.02
241	0.01
242	0.01
243	0.01
244	0.01
245	0.02
246	0.02
247	0.02
248	0.02
249	0.02
250	0.02
251	0.02
252	0.03
253	0.05
254	0.12
255	0.15
256	0.16
257	0.18
258	0.22
259	0.28
260	0.36
261	0.42
262	0.45
263	0.49
264	0.55
265	0.56
266	0.55
267	0.5
268	0.43
269	0.37
270	0.32
271	0.25
272	0.19
273	0.15
274	0.14
275	0.13
276	0.13
277	0.11
278	0.07
279	0.07
280	0.07
281	0.08
282	0.12
283	0.11
284	0.12
285	0.12
286	0.1
287	0.11
288	0.12
289	0.13
290	0.1
291	0.12
292	0.12
293	0.2
294	0.24
295	0.29
296	0.29
297	0.3
298	0.34
299	0.35
300	0.41
301	0.36
302	0.32
303	0.28
304	0.31
305	0.31
306	0.3
307	0.27
308	0.22
309	0.25
310	0.3
311	0.3
312	0.26
313	0.28
314	0.26
315	0.27
316	0.29
317	0.23
318	0.22
319	0.2
320	0.23
321	0.19
322	0.19
323	0.17
324	0.14
325	0.13
326	0.08
327	0.08
328	0.04
329	0.03
330	0.02
331	0.02
332	0.02
333	0.02
334	0.02
335	0.02
336	0.04
337	0.06
338	0.06
339	0.07
340	0.07
341	0.08
342	0.08
343	0.09
344	0.09
345	0.07
346	0.08
347	0.07
348	0.07
349	0.06
350	0.06
351	0.05
352	0.03
353	0.04
354	0.03
355	0.03
356	0.03
357	0.03
358	0.04
359	0.05
360	0.06
361	0.07
362	0.07
363	0.07
364	0.08
365	0.08
366	0.08
367	0.09
368	0.08
369	0.09
370	0.1
371	0.1
372	0.09
373	0.11
374	0.1
375	0.09
376	0.09
377	0.08
378	0.09
379	0.09
380	0.09
381	0.08
382	0.09
383	0.09
384	0.1
385	0.09
386	0.1
387	0.19
388	0.22
389	0.27
390	0.29
391	0.34
392	0.38
393	0.43
394	0.5
395	0.51
396	0.49
397	0.5
398	0.53
399	0.48
400	0.47
401	0.43
402	0.34
403	0.25
404	0.25
405	0.2
406	0.15
407	0.19
408	0.18
409	0.19
410	0.19
411	0.24
412	0.23
413	0.26
414	0.35
415	0.35
416	0.35
417	0.32
418	0.33
419	0.31
420	0.31
421	0.31
422	0.32
423	0.32
424	0.31
425	0.32
426	0.33
427	0.32
428	0.36
429	0.35
430	0.3
431	0.35
432	0.39
433	0.45
434	0.47
435	0.45
436	0.4
437	0.38
438	0.35
439	0.28
440	0.25
441	0.21
442	0.23
443	0.32
444	0.32
445	0.33
446	0.35
447	0.34
448	0.35
449	0.33
450	0.29
451	0.22
452	0.21
453	0.22
454	0.2
455	0.18
456	0.15
457	0.18
458	0.17
459	0.24
460	0.26
461	0.26
462	0.29
463	0.33
464	0.41
465	0.44
466	0.55
467	0.57
468	0.67
469	0.74
470	0.76
471	0.82
472	0.85
473	0.88
474	0.87
475	0.82
476	0.8
477	0.76
478	0.73
479	0.66
480	0.59
481	0.55
482	0.48
483	0.47
484	0.4
485	0.37
486	0.32
487	0.28
488	0.25
489	0.18
490	0.16
491	0.1
492	0.09
493	0.08
494	0.09
495	0.1
496	0.12
497	0.14
498	0.2
499	0.3
500	0.38
501	0.46
502	0.56
503	0.66
504	0.75
505	0.84
506	0.89
507	0.91
508	0.93

A0A395HT72

3D AlphaFold-predicted Structure Viewer