Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319E7I0

Protein Details
Accession A0A319E7I0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-99TNYPTVGAKKKEKKESKKKKEKEGEKERNNPPFARBasic
NLS Segment(s)
PositionSequence
72-100AKKKEKKESKKKKEKEGEKERNNPPFARK
Subcellular Location(s) nucl 16, mito_nucl 13.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MYLHVAYTYARHTPPSNNPGIQFMHDHSTLPPFHPTQPNQKSPFSPTSPVQMAHDNPTPWYQPTTNYPTVGAKKKEKKESKKKKEKEGEKERNNPPFARKLAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.45
4 0.43
5 0.43
6 0.44
7 0.43
8 0.38
9 0.31
10 0.26
11 0.24
12 0.22
13 0.22
14 0.19
15 0.21
16 0.2
17 0.19
18 0.21
19 0.18
20 0.23
21 0.29
22 0.32
23 0.38
24 0.45
25 0.51
26 0.52
27 0.52
28 0.49
29 0.48
30 0.5
31 0.42
32 0.38
33 0.31
34 0.32
35 0.31
36 0.3
37 0.26
38 0.23
39 0.21
40 0.21
41 0.23
42 0.18
43 0.18
44 0.2
45 0.19
46 0.17
47 0.19
48 0.15
49 0.15
50 0.21
51 0.27
52 0.28
53 0.27
54 0.28
55 0.3
56 0.36
57 0.41
58 0.41
59 0.43
60 0.5
61 0.58
62 0.68
63 0.73
64 0.78
65 0.82
66 0.88
67 0.9
68 0.91
69 0.91
70 0.92
71 0.92
72 0.92
73 0.91
74 0.91
75 0.91
76 0.9
77 0.91
78 0.89
79 0.87
80 0.81
81 0.74
82 0.69
83 0.66