Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8NJY0

Protein Details
Accession A8NJY0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-22CRPTPEQRSKLDKRRSQNENGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9
Family & Domain DBs
KEGG cci:CC1G_11728  -  
Amino Acid Sequences MCRPTPEQRSKLDKRRSQNENGHRGENGHPGIPATVTTDIGKEEVYGEGDPDPSELLPQMVHPGMSGEGSSHPIVMGLKRREPVVPVTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.8
4 0.8
5 0.8
6 0.79
7 0.79
8 0.74
9 0.66
10 0.57
11 0.53
12 0.46
13 0.42
14 0.34
15 0.24
16 0.21
17 0.19
18 0.19
19 0.16
20 0.14
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.06
30 0.06
31 0.05
32 0.07
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.08
47 0.08
48 0.08
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.06
55 0.07
56 0.11
57 0.11
58 0.1
59 0.09
60 0.1
61 0.11
62 0.15
63 0.23
64 0.25
65 0.3
66 0.31
67 0.33
68 0.34
69 0.35