Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DT31

Protein Details
Accession A0A319DT31   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-33QDTPFIKKRRNRLSTTRTKQLIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019180  Oxidoreductase-like_N  
Pfam View protein in Pfam  
PF09791  Oxidored-like  
Amino Acid Sequences MSPEPLPIYTPQDTPFIKKRRNRLSTTRTKQLIRAAERAYDSPPPPPGLGECCGSSCDPCVTDLWKEELAVWRERWGEGAVEDGGLNSSSSSGSSSGSSTTEGKEGCGKEKMPGSWEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.45
4 0.51
5 0.55
6 0.64
7 0.68
8 0.75
9 0.75
10 0.76
11 0.78
12 0.81
13 0.82
14 0.81
15 0.75
16 0.69
17 0.65
18 0.62
19 0.6
20 0.53
21 0.51
22 0.43
23 0.4
24 0.4
25 0.37
26 0.32
27 0.29
28 0.25
29 0.22
30 0.22
31 0.21
32 0.19
33 0.19
34 0.18
35 0.16
36 0.17
37 0.16
38 0.14
39 0.13
40 0.15
41 0.14
42 0.13
43 0.11
44 0.1
45 0.09
46 0.09
47 0.09
48 0.09
49 0.1
50 0.11
51 0.13
52 0.13
53 0.13
54 0.13
55 0.18
56 0.19
57 0.21
58 0.2
59 0.2
60 0.21
61 0.2
62 0.21
63 0.16
64 0.14
65 0.11
66 0.13
67 0.1
68 0.09
69 0.09
70 0.07
71 0.07
72 0.07
73 0.07
74 0.04
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.07
81 0.08
82 0.09
83 0.1
84 0.1
85 0.13
86 0.13
87 0.14
88 0.16
89 0.15
90 0.17
91 0.22
92 0.23
93 0.25
94 0.29
95 0.28
96 0.3
97 0.36
98 0.37